DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinb3d

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_958764.1 Gene:Serpinb3d / 394252 MGIID:2683295 Length:387 Species:Mus musculus


Alignment Length:385 Identity:105/385 - (27%)
Similarity:176/385 - (45%) Gaps:42/385 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLG------------PGDAD 87
            :||..:...  :.|:..||.::..::|:..:|||..|..::::.|...            ..|.:
Mouse    14 ELYRQLRES--DNNIFYSPISMMRTLAMLLLGAKANTEQQIKKVLHFNETTKKTTEKSAESHDEE 76

  Fly    88 AVSQRSGSYQQALTRDNNF------RLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDF-HPPY 145
            .|.|:   :|..:|:.|.|      ::.|:||..::..|..:|....::.:.:|::.||| |.. 
Mouse    77 NVHQQ---FQMLMTQLNKFNNAYDLKVPNSIYGAKDFPFLQTFLKDIRKYYQANVESLDFAHAA- 137

  Fly   146 NKRTADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGS 210
             :.:...||..:|.:|||||.|:..:..||..|..|:||.|.:...|...|....|.:..|....
Mouse   138 -EESQKKINSWMARQTNGKIKDLFPSGSLNSSTILVLVNAVYFKGQWNHKFDEKHTREEKFWLNK 201

  Fly   211 GQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKNLLAE 275
            ..|..|..|.....||:..:.::.||:||:||:..:.||.:|||...|||:..::.|:...||..
Mouse   202 NTSKPVQMMKQRNKFNFIFLENVQAKIVEIPYKGKELSMFVLLPVEIDGLKKFEEQLTADKLLQW 266

  Fly   276 IGAMSQQKVEVL--LPKFSVTFGLGLEGPFKKLGVHTMFS-RDGDFGNMYRMFVSHFINAVEHKA 337
            ..|.:....|:.  ||:|.|.....|..|.:.:|:...|. :..||..|... ....::.|.||:
Mouse   267 TRAENMHMTELYLSLPQFKVEEKYDLRVPLEHMGMVDAFDPQKADFSGMSNS-QGLVVSKVLHKS 330

  Fly   338 NVEVTEAGVDQPLETGLLKGLFSRS------KKFEADHPFVFAIKYK--DSIAFIGHIAN 389
            .|||.|.|.    |......:.|||      ..|..:|||:|.:|..  :||.|.|.:::
Mouse   331 FVEVNEEGA----EAATAMSVESRSLSVPKPNDFSCNHPFLFVMKQNKTNSILFFGRVSS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 105/381 (28%)
Serpinb3dNP_958764.1 SERPIN 7..387 CDD:294093 105/385 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.