DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinb3c

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_958751.2 Gene:Serpinb3c / 381286 MGIID:1277952 Length:386 Species:Mus musculus


Alignment Length:371 Identity:100/371 - (26%)
Similarity:179/371 - (48%) Gaps:35/371 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 NENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGP------------GDADAVSQRSGSYQQ 98
            ::|:..||.::.:::.:..:||||.|..::::.|:...            .|.|.|.::   :|:
Mouse    23 DKNIFYSPISMITALGMLKLGAKGNTEIQIEKVLQCNETTEKTTEKSAHCDDEDNVHEQ---FQK 84

  Fly    99 ALTR------DNNFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDF-HPPYNKRTADGINRA 156
            .:|:      |.:.:.||:||..:......:|.:..:..:.:|::.||| |..  :.:...||..
Mouse    85 LITQLNKSNDDYDLKAANSIYGAKGFPLLQTFLEDIKEYYHANVESLDFEHAA--EESEKKINFW 147

  Fly   157 VATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWT 221
            |..:|||||.|:..:..|:..|:.|:||.|.:...|...|..:.|.:..|......|:.|..|..
Mouse   148 VKNETNGKIKDLFPSGSLSSSTKLVLVNAVYFKGRWNHKFDENNTIEEMFWLNKNTSIPVPMMKQ 212

  Fly   222 LQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKNLLAEIGAMSQQKVEV 286
            ...|.::.:..:.|::||:||:..:.||.:|||...|||:.|::.|:...||....|.:....|:
Mouse   213 RNKFMFSFLEDVQAQIVEIPYKGKELSMFVLLPMEIDGLKQLEKQLTAAKLLEWTRAENMHLTEL 277

  Fly   287 L--LPKFSVTFGLGLEGPFKKLGVHTMFS-RDGDFGNMYRMFVSHFINAVEHKANVEVTEAGVDQ 348
            .  ||:|.|.....|..|.:.:|:...|. :..||..| .......::.|.||:.|||.|.|.:.
Mouse   278 YLWLPRFKVEEKYDLPVPLECMGMVNAFDPQKADFSGM-SSTQGLVVSKVLHKSFVEVNEEGTEA 341

  Fly   349 PLETG---LLKGLFSRSKKFEADHPFVFAIKYK--DSIAFIGHIAN 389
            ...:|   :|:  .::...|..||||:|.|.:.  :||.|.|.|::
Mouse   342 DPASGEEVILR--LAQVADFRCDHPFLFFIIHSKTNSILFFGRISS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 99/367 (27%)
Serpinb3cNP_958751.2 SERPIN 6..386 CDD:294093 100/371 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.