DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinb9

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_006253934.1 Gene:Serpinb9 / 361241 RGDID:1549730 Length:396 Species:Rattus norvegicus


Alignment Length:400 Identity:105/400 - (26%)
Similarity:188/400 - (47%) Gaps:39/400 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CLLLLLATVSQSKTVGYDAAADRNLLAADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQT 71
            |.|.::.|:|::          ....|..|...:...:.:|||..||.:|.|::|:..:||||||
  Rat    18 CRLCIMNTLSEA----------NGTFAIHLLKMLCQSNPSENVCYSPVSISSALAMVLLGAKGQT 72

  Fly    72 ASELQQGLRLGPGDADAVSQRSGSYQQALT------RDNNFRLANNIYINENLEFKGSFRDVAQR 130
            ..::.|.|.|     :........:|..|:      |..:.|:||.::.::..|...::::...|
  Rat    73 QVQISQALGL-----NKEKDLHQGFQLLLSNLNKPERKYSLRVANRLFADKTCELLPTYKESCLR 132

  Fly   131 QFDSNIDKLDFHPPYNKRTADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKA 195
            .::|.:::|.| ....:.:...||..|:.:|.|||.::|....::..|..|:||.:.:...|.:.
  Rat   133 FYNSEMEQLSF-AEAAEESRKHINTWVSKQTEGKIPELLSGGSVDSETRLVLVNALYFKGRWHQP 196

  Fly   196 FRLDKTEKRSFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGL 260
            |..:.|....|:....:...|..|.....:|.|.|..:.|:|:.:||:..:.|.::|||:....|
  Rat   197 FNKEYTVDMPFKINKNEKRLVQMMCCEDTYNLAHVKEVQAQVLMMPYEGMELSFVVLLPDNDGDL 261

  Fly   261 RSLQQSLSGKNLLAEIGA--MSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSR-DGDFGNM- 321
            ..::.:|:.:.|.|....  |....|||.||||.:.....:|..|::||:..:|.. ..|...| 
  Rat   262 SKVESNLTFEKLTAWTNPDFMKNTNVEVFLPKFKLQEDYDMESVFQRLGIVDVFQEAKADLSAMS 326

  Fly   322 --YRMFVSHFINAVEHKANVEVTEAGVDQPLETGLLK---GLFSRSKKFEADHPFVFAIKYK--D 379
              ..:.||..:    ||:.|||.|.|.:....:.:::   ..|..:  |.|||||:|.||:.  :
  Rat   327 PERNLCVSKIV----HKSLVEVNEEGTEAAAASAVIEYCCAAFVPT--FCADHPFLFFIKHNKTN 385

  Fly   380 SIAFIGHIAN 389
            ||.|.|..::
  Rat   386 SILFCGRFSS 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 101/373 (27%)
Serpinb9XP_006253934.1 SERPIN 26..396 CDD:294093 102/391 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.