DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Spn28B

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster


Alignment Length:397 Identity:105/397 - (26%)
Similarity:178/397 - (44%) Gaps:47/397 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLATVSQSKTVGYDAAADRNLLAADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTAS 73
            ||||||..:|   |:         ..|.|..:|:.:...|::.||.:.:..|::.::.:.|:|..
  Fly     6 LLLLATSVES---GF---------WEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFE 58

  Fly    74 ELQQGLRLGPGDADAVSQRSGSYQQALTRDNNF---RLANNIYINENLEFKGSFRDVAQRQFDSN 135
            ||:..|:... :...|:....|....|.|...|   .:||.||:|:.......|..:|::.|.:.
  Fly    59 ELRNVLKFSE-NKTLVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAK 122

  Fly   136 IDKLDFHPPYNKRTADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDK 200
            ...:....|.:....  :|..:..:|.|.|.:|:..:..|..|...:||.:.:...|...|:.|:
  Fly   123 AKSIRLDDPVSASAI--VNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQ 185

  Fly   201 TEKRSFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQ 265
            |....|...:.:.:.|..|....:.....::.:|||::||||.|...||.::|||..||||.|::
  Fly   186 THIADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKE 250

  Fly   266 SLSGKNLLAEIG----AMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRDGDFGNMYRMFV 326
                     ::|    .:.::.|.|.||||.:.....|:|.|:.||:..:|....|...:. :..
  Fly   251 ---------KVGFIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLV-LES 305

  Fly   327 SHFINAVEHKANVEVTEAGVDQPLETGLLKGLFSRSKK-----------FEADHPFVFAIKYKDS 380
            ...|:.:..||.:::.|.|.:....||:|    :|.||           |.|||||.:.|.....
  Fly   306 GAKIDKIVQKAFLKIDEKGGEASAATGVL----TRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV 366

  Fly   381 IAFIGHI 387
            |.|.|||
  Fly   367 IYFQGHI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 95/374 (25%)
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 95/381 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446372
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.