DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and serpinb1l4

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_956235.2 Gene:serpinb1l4 / 335229 ZFINID:ZDB-GENE-030131-7169 Length:433 Species:Danio rerio


Alignment Length:441 Identity:110/441 - (24%)
Similarity:193/441 - (43%) Gaps:90/441 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AADRNLLAADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLG-------- 82
            :|.....:.:|:..::..:.:.||..||.:|.|::|:..:||||.||.::.:.|...        
Zfish     5 SAANTQFSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNNPPKPGGA 69

  Fly    83 -PGDADAVSQ-------RSGSYQQALTRDNNFR-------------------------------- 107
             |..|.|..:       :|....|||.:...|.                                
Zfish    70 TPTPAQATQKPKWTCGVKSQHEPQALQQPQKFELPADLKKCPAQPVPGQKAEEQIHSSFNKLMSE 134

  Fly   108 -----------LANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRTAD--GINRAVAT 159
                       |||.:|..:..:|...:...|::.:.:.::|:||.   ||..|.  .||:.|..
Zfish   135 LNKPGAPYVLSLANRLYGEQTYQFLEKYLSDAKKYYAAGLEKVDFK---NKSEASCVNINKWVEK 196

  Fly   160 KTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWTLQN 224
            .|..||.|:|.:..::..|..|:||.:.:...|:|.|..:.|:...|:....|:..|..|.....
Zfish   197 NTQEKIKDLLPSGAIDAMTRLVLVNAIYFKGNWEKKFPKEATKDGQFKLNKNQTKPVKMMHQKAQ 261

  Fly   225 FNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKD----GLRSLQQSLSGKNLLAEIGAMSQQKVE 285
            |.:..:..::::::||||...:.|||::||:..:    ||:.|:::|:.:.|:.....|.||:|:
Zfish   262 FPFVVIPEINSQILELPYVGKNLSMLIILPDEIEDATTGLQKLERALTYEKLMQWTKVMRQQEVQ 326

  Fly   286 VLLPKF---------SVTFGLGLEGPFKKLGVH-TMFSRDGDFGNMYRMFVSHFINAVEHKANVE 340
            |.||||         |:...:|:|..|....|: |..|...|.          .::.|.|||.||
Zfish   327 VSLPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDL----------VLSKVIHKAFVE 381

  Fly   341 VTEAGVDQPLETGLLKGLFSRSKKFEADHPFVFAIKYK--DSIAFIGHIAN 389
            |.|.|.:....||.:..:.:.::.|.|||||:|.|::.  ::|.|.|...:
Zfish   382 VNEEGTEAAAATGAVVSIRTLAQIFNADHPFLFFIRHNSTNTILFYGRFCS 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 109/433 (25%)
serpinb1l4NP_956235.2 SERPIN 4..433 CDD:294093 110/441 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.