DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinb1b

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_038952280.1 Gene:Serpinb1b / 306891 RGDID:1560658 Length:380 Species:Rattus norvegicus


Alignment Length:384 Identity:105/384 - (27%)
Similarity:180/384 - (46%) Gaps:37/384 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NLLAADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGP----GDADAVS 90
            :|.|.:|::.::......| :.||.:|.|::|:.|:||||.:|   ...|||..    ...:.:.
  Rat     9 SLFALELFHTLSESSPTGN-IFSPFSISSALAMVFLGAKGSSA---PSSLRLAETFHFDSVEDIH 69

  Fly    91 QRSGSYQQALTR---DNNFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDF-HPPYNKRTAD 151
            .|..|....:.:   .:..::||.:|..:...|...|....|:.:.:::..:|| |...:.|.. 
  Rat    70 SRFQSLNAEMRKHGASHTLKVANRLYGEKTYNFLPEFLASTQKMYGADLAPVDFQHASEDARKE- 133

  Fly   152 GINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKV 216
             ||:.|..:|.|||.::|...::|..|:.|:||.:.:...||:.|....|....||.....:..|
  Rat   134 -INKWVKGQTEGKIPELLAGGVVNSTTKLVLVNAIYFKGIWQEKFLTRHTTDAPFRLNKKDTKMV 197

  Fly   217 DTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLP----NRKDGLRSLQQSLSGKNL----- 272
            ..|:..:.|.:..:..|..||:|:|||..:.||::|||    :...||:.:::.|:.:.|     
  Rat   198 KMMYQKEKFPFGYIPDLKCKVLEMPYQGGELSMVILLPEDIEDESTGLQKIEEQLTLEKLYEWTK 262

  Fly   273 ---LAEIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRD-GDFGNMYRMFVSHFINAV 333
               |.||      .|.|.||||.:.....|.....:||:..:||.. .|...|... ...||:.:
  Rat   263 HENLKEI------DVHVNLPKFKIEESYILNSNLGRLGLQDLFSSSKADLSGMSES-RDIFISKI 320

  Fly   334 EHKANVEVTEAGVDQPLET-GLLKGLFSRSKKFEADHPFVFAIKYKD--SIAFIGHIAN 389
            .||:.|||.|.|.:....| ||::......:.|..||||:|.|::..  ::.|.|.:.:
  Rat   321 VHKSFVEVNEEGTEAAAATAGLVEYCLVSIEAFIVDHPFLFFIRHNPTANMLFFGRVCS 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 105/380 (28%)
Serpinb1bXP_038952280.1 serpinB1_LEI 1..380 CDD:381028 105/384 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.