DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinb9d

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001100821.1 Gene:Serpinb9d / 306890 RGDID:1308725 Length:337 Species:Rattus norvegicus


Alignment Length:345 Identity:88/345 - (25%)
Similarity:166/345 - (48%) Gaps:26/345 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LAFVGAKGQTASELQQGLRLGPGDADAVSQRSGSYQQALTRDNN------FRLANNIYINENLEF 120
            :..:||||.||.::.|.|.|.....:.:.:   .:|..|...|.      .|:||.::.....:.
  Rat     1 MVLLGAKGDTAVQISQALNLNKHPDEDIHK---DFQLLLHNLNKPKSHYCLRIANRLFAENTCKL 62

  Fly   121 KGSFRDVAQRQFDSNIDKLDFHPPYNKRTADGINRAVATKTNGKITDILRAELLNDRTEGVIVNG 185
            ..::::...|.::|.|::|.| ....:.:...||..|:.:|.|||.::|.::.:...|:.::||.
  Rat    63 VPTYKESCLRFYNSEIEQLSF-AKAAEESRKHINTWVSKQTEGKIPELLSSDSVGSETKLIMVNA 126

  Fly   186 VSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSML 250
            :.:..:|...|..:.|.:..|:....::..|..||..:.|:.|.|..:.|:::.:||:..:.|.:
  Rat   127 LYFQGSWLHCFDKEFTMEMPFKINKKETKPVQMMWQEETFDVAYVKEIQAQILVMPYRGMEMSFM 191

  Fly   251 LLLPNRKDGLRSLQQSLSGKNLLA--EIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFS 313
            :|||:....:|.::.||:.:.|.|  :...:...:|.|.||||.:.....:...|:.||:..:||
  Rat   192 VLLPDEGVDIRKVESSLTFEKLTAWTKPEFIYSTEVYVYLPKFQLQEQYDMTALFQHLGMIDVFS 256

  Fly   314 R-DGDFGNM---YRMFVSHFINAVEHKANVEVTEAGVDQPLETGLLKGLFSRSK---KFEADHPF 371
            . ..|...|   ..:.||.|:    |:..|||.|.|.:....:. ....:|.|:   .|.||.||
  Rat   257 EIKADLSGMCPEKDLCVSKFV----HECVVEVNEEGTEAAAASA-ADCCYSCSEYTPTFCADRPF 316

  Fly   372 VFAIKYK--DSIAFIGHIAN 389
            :|.|::.  :||.|.|..::
  Rat   317 LFFIRHNQTNSILFCGRFSS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 88/341 (26%)
Serpinb9dNP_001100821.1 SERPIN 1..337 CDD:294093 88/345 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.