DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and RGD1564786

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_006253935.2 Gene:RGD1564786 / 306889 RGDID:1564786 Length:420 Species:Rattus norvegicus


Alignment Length:411 Identity:109/411 - (26%)
Similarity:189/411 - (45%) Gaps:36/411 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AVIISCLLLLLATVSQSKTVGYDAAADRN-LLAADLYNAVAADHLNENVVISPATIQSSMALAFV 65
            |....|:.::...:..|:....|.....| ..|..|:..:..| :::||..|..:|.|::::..:
  Rat    22 AYTFDCVFMMFIVILHSRLTIMDPLLKANGNFAIKLFKVLGED-ISKNVFFSLPSISSALSMILM 85

  Fly    66 GAKGQTASELQQGLRL------GPGDADAVSQRSGSYQQALTRDNN------FRLANNIYINENL 118
            ||.|.|||::.|.:.|      |.||   |.|.   :...||:.|.      .|.||:::|.::.
  Rat    86 GANGTTASQICQAMSLDKCNSIGGGD---VHQH---FLSLLTKVNKTDTRCMLRKANSVFIEDSF 144

  Fly   119 EFKGSFRDVAQRQFDSNIDKLDFH-PPYNKRTADGINRAVATKTNGKITDILRAELLNDRTEGVI 182
            |...||:|...:.:::.|::|||. .|...|  ..||..||.||...|.::|....:|..|...:
  Rat   145 EILASFKDACHKLYEAEIEELDFKGAPEQSR--QHINTWVAKKTEDIIRELLPPCTVNSNTCLFL 207

  Fly   183 VNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDF 247
            ||.:.:..:.:|.|....|.:..|:....:...|..|.....|....|..:..:|:.||::|...
  Rat   208 VNVIYFKGSLEKPFNKADTREMPFKVSMNEKKTVQMMSQKSTFKMTYVKDISTQVLTLPFENSIL 272

  Fly   248 SMLLLLPNRKDGLRSLQQSLSGKNLL--AEIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHT 310
            ||...:|:.....|.|:..|:....|  .:...|.::::||.||:..:.....:.|..:|||:..
  Rat   273 SMYFFVPDSHVAQRKLENELTYDKFLEWTDEDTMEEKEMEVFLPRIKLEESYDMNGVLRKLGMTD 337

  Fly   311 MFSRD-GDFGNMYRMFVSH--FINAVEHKANVEVTEAGVD--QPLETGLLKGLFSRSKKFEADHP 370
            .|..| .||..:..   .|  |::.|.||:.||::|.|.:  .|.:...:|...: .:...||||
  Rat   338 AFEEDKADFSGISS---KHGLFLSKVVHKSFVEMSEEGTEAAAPTDVVTMKSPLT-PRCLIADHP 398

  Fly   371 FVFAIKYKDS--IAFIGHIAN 389
            |:|:|:...|  |.|:|..::
  Rat   399 FLFSIQDTRSKEILFLGRFSS 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 105/379 (28%)
RGD1564786XP_006253935.2 SERPIN 46..420 CDD:294093 105/387 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.