DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinc1

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001012027.1 Gene:Serpinc1 / 304917 RGDID:1307404 Length:465 Species:Rattus norvegicus


Alignment Length:391 Identity:99/391 - (25%)
Similarity:189/391 - (48%) Gaps:55/391 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AADLYNAVA-ADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGDADAVSQRSGS- 95
            |.:.|..:| :.:.|:|:.:||.:|.::.|:..:||...|..:|.:..:.     |.:|:::.. 
  Rat    92 ATNFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNNTLKQLMEVFKF-----DTISEKTSDQ 151

  Fly    96 ------------YQQALTRDNNFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDF--HPPYN 146
                        |::| .:.:|...||.::.:::|.|..|::||::..:.:.:..|||  :|..:
  Rat   152 IHFFFAKLNCRLYRKA-NKSSNLVSANRLFGDKSLTFNESYQDVSEIVYGAKLQPLDFKENPEQS 215

  Fly   147 KRTADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSG 211
            :.|   ||..||.||.|:|.|::....:::.|..|:||.:.:...|:..|..:.|.|..|....|
  Rat   216 RVT---INNWVANKTEGRIKDVIPQGAIDELTALVLVNTIYFKGLWKSKFSPENTRKEPFHKVDG 277

  Fly   212 QSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKNLLAEI 276
            ||..|..|:....|.|..|.. ..:|:|:|::..|.:|:|:||..:..|..::|.|:.:.|...:
  Rat   278 QSCLVPMMYQEGKFKYRRVGE-GTQVLEMPFKGDDITMVLILPKPEKSLAKVEQELTPELLQEWL 341

  Fly   277 GAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFS-------------RDGDFGNMYRMFVSH 328
            ..:|:..:.|.:|:|.:.....|:...:.:|:..:||             ||.       :|||.
  Rat   342 DELSEVMLVVHVPRFRIEDSFSLKEQLQDMGLVDLFSPEKSQLPGIIAEGRDD-------LFVSD 399

  Fly   329 FINAVEHKANVEVTEAGVDQPLETGLL---KGLFSRSKKFEADHPFVFAIK--YKDSIAFIGHIA 388
            ..    |||.:||.|.|.:....|.::   :.|......|:|:.||:..|:  ..::|.|:|.::
  Rat   400 AF----HKAFLEVNEEGSEAAASTSVVITGRSLNPSRVTFKANRPFLVLIREVALNTIIFMGRVS 460

  Fly   389 N 389
            |
  Rat   461 N 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 98/387 (25%)
Serpinc1NP_001012027.1 antithrombin-III_like 80..459 CDD:239000 98/387 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.