DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and LOC299282

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001376144.2 Gene:LOC299282 / 299282 RGDID:3745 Length:413 Species:Rattus norvegicus


Alignment Length:424 Identity:102/424 - (24%)
Similarity:187/424 - (44%) Gaps:55/424 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISCLLLLLATVSQS----KTVGYDA-----------------AADRNLLAADLYNAVAADHLNEN 48
            |:.|.||:|.:..:    .|:|.|.                 |:.....|..||..:|..:.::|
  Rat     4 IAALGLLMAGICPAVLCDGTLGRDTLSHEDHGKGRQLHSLTLASSNTDFALSLYKKLALRNPDKN 68

  Fly    49 VVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGD--ADAVSQRSGSYQQALTRDNN---FRL 108
            ||.||.:|.:::.:..:|||..|..|:.:||:....:  .:.:.|..|...|.|::..:   ...
  Rat    69 VVFSPLSISAALTILSLGAKDSTMEEILEGLKFNLTEITEEEIHQGFGHLLQRLSQPEDQVEINT 133

  Fly   109 ANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRTADGINRAVATKTNGKITDILRAEL 173
            .:.::|::.......|::..:..:.:.....||..|...:..  ||..|:.:|.|||     |||
  Rat   134 GSALFIDKEQPILSEFQEKTRALYQAEAFIADFKQPNEAKKL--INDYVSNQTQGKI-----AEL 191

  Fly   174 LND---RTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWTLQ-NFNYAEVNSLD 234
            .:|   ||..|:||.:.:...|:..|..:.|.:..|.....:||||..|...: ...|.....|.
  Rat   192 FSDLEERTSMVLVNYLLFKGKWKVPFNPNDTFESEFYLDEKRSVKVPMMKIKEVTTPYVRDEELS 256

  Fly   235 AKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKNLLAEIGAMSQQKV-EVLLPKFSVTFGLG 298
            ..|:||.|.. :.|.|.:||: :..::.::.||..:.|.....::..:.: ::.:||||::....
  Rat   257 CSVLELKYTG-NASALFILPD-QGKMQQVESSLQPETLKKWKDSLIPRIINDLRMPKFSISTDYS 319

  Fly   299 LEGPFKKLGVHTMFSRDGDFG------NMYRMFVSHFINAVEHKANVEVTEAGVDQPLETGLLKG 357
            |:....:||:..:||:..|..      ::|       ::.|.|||.::|.|.|.:....||:...
  Rat   320 LKEVLPELGIKKVFSQQADLSRITGTKDLY-------VSQVVHKAVLDVDETGTEATAATGVATV 377

  Fly   358 LFSRSKKFEADHPFVFAIKYKD--SIAFIGHIAN 389
            :..:.:....:.||:..|...|  ||.|:..|.|
  Rat   378 IRRQPRTLNFNRPFMVVITDMDSQSILFVAKITN 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 91/374 (24%)
LOC299282NP_001376144.2 serpinA3_A1AC 36..413 CDD:381019 94/392 (24%)
RCL 365..389 3/23 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.