DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and LOC299277

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_008763124.2 Gene:LOC299277 / 299277 RGDID:1595900 Length:420 Species:Rattus norvegicus


Alignment Length:331 Identity:83/331 - (25%)
Similarity:145/331 - (43%) Gaps:22/331 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGDADAVSQRSGSYQ 97
            |..||..:|..:.|:|:..||.:|.:::|...:||||.|..|:.:||:....:...:.... :|:
  Rat    55 AFSLYKELALKNPNKNIAFSPLSISAALASLSLGAKGNTLQEILEGLKFNLTETTEIDIHQ-NYR 118

  Fly    98 QALTR------DNNFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRTADGINRA 156
            ..|.|      ......||.:::.::|:....|::.|:..:.:.:...||......|..  ||..
  Rat   119 DLLQRLSQPGGQGQISRANLLFVEKHLQILNGFKEKAKALYQTEVFATDFQQTCEARKF--INDY 181

  Fly   157 VATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWT 221
            |..::.|||.:::..  |.:||..|::|.:.::..|...|..|.|....|...|.:.|||..|.|
  Rat   182 VMIQSQGKIKEMVTE--LEERTSIVMLNFLLFTGQWSVPFDPDDTFMGKFILDSRRPVKVLMMKT 244

  Fly   222 LQ-NFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKNLLAEIGAMSQQKVE 285
            .. ...|.....|...||||.|:....:|.:|....|  :..::.||....|.....::..:.::
  Rat   245 EDLTTPYFWDEELKCTVVELNYKGHGKAMFILPDQGK--MEQVEASLHPGTLRKWTDSLKPRIID 307

  Fly   286 VL-LPKFSVTFGLGLEGPFKKLGVHTMFSRDGDFGNM---YRMFVSHFINAVEHKANVEVTEAGV 346
            .| |||||::....||....:||:..:|:...|...:   ..:.||..|    |...:.:.|.|.
  Rat   308 ELHLPKFSLSKTYKLENILPELGIMDVFNTQADLSGIAGAKDVRVSQMI----HNTVLGMAETGT 368

  Fly   347 DQPLET 352
            :....|
  Rat   369 EAEATT 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 83/331 (25%)
LOC299277XP_008763124.2 serpinA3_A1AC 37..417 CDD:381019 83/331 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.