DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpina9

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001100224.1 Gene:Serpina9 / 299274 RGDID:1304789 Length:417 Species:Rattus norvegicus


Alignment Length:419 Identity:96/419 - (22%)
Similarity:188/419 - (44%) Gaps:57/419 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISCLLLLLAT-------VSQSKTVGYDAAADRNLLAADLYNAVAADHLNENVVISPATIQSSMAL 62
            :||:|...:.       :|..:.............|..||..:|.....:|::.||.:|.:|:|:
  Rat    18 MSCMLSFNSNHRECPHPLSMKRNPASQVTPSNTKFAFLLYQRLAQKSPGQNILFSPVSISTSLAM 82

  Fly    63 AFVGAKGQTASELQQGL------------RLGPGDADAVSQRSGSYQQAL------TRDNNFRLA 109
            ..:||...|.:::.:.|            .||             ::|.:      .:|...|:.
  Rat    83 LSLGACSATKTQILRSLGFNITHIAEHTIHLG-------------FEQLVHSLNECHKDLELRMG 134

  Fly   110 NNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRTADG-INRAVATKTNGKITDILRAEL 173
            :.::|.:.|:.:..|.|..::.:.:.:...||.   |..||.. ||..|..:|.||:.|:::.  
  Rat   135 SVLFIRKELQLQVKFLDRVKKLYGTKVFSEDFS---NAVTAQAQINSYVERETKGKVVDVIQD-- 194

  Fly   174 LNDRTEGVIVNGVSYSAAWQKAFRLDKTEKR-SFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKV 237
            |:.:|..|:||.:.:.|.|.:.|....|.|. .|....|.:|.|..|...::|.:.....|...:
  Rat   195 LDSQTAMVLVNHIFFKANWTQPFSAANTNKSFPFLLSKGTTVHVPMMHQTESFAFGVDRELGCSI 259

  Fly   238 VELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKNLLAEIGAMSQQKVEVLLPKFSVTFGLGLEGP 302
            :::.|:. |.....:||. |..:|.|::|||.:.|.....::.::.::|.:||||::....||..
  Rat   260 LQMDYRG-DAVAFFVLPG-KGKMRQLERSLSPRRLRRWSRSLQKRWIKVFIPKFSISASYNLETI 322

  Fly   303 FKKLGVHTMFSRDGDFGNMYRMFVSHF--INAVEHKANVEVTEAGVDQPLETG---LLKGLFSRS 362
            ..::|:...|:.:.||..:.:   :||  ::...|||.::|:|.|.:....|.   :::...:.|
  Rat   323 LPEMGIRDAFNSNADFSGITK---THFLQVSKAAHKAVLDVSEEGTEAAAATTTKLIVRSRDTPS 384

  Fly   363 KKFEADHPFVFAI--KYKDSIAFIGHIAN 389
            .....:.||:..:  |..:||.|:|.:.|
  Rat   385 STIAFNEPFLILLLDKNTESILFLGKVEN 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 91/383 (24%)
Serpina9NP_001100224.1 serpin 32..417 CDD:422956 93/405 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.