DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpina6

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001009663.1 Gene:Serpina6 / 299270 RGDID:1595901 Length:396 Species:Rattus norvegicus


Alignment Length:405 Identity:92/405 - (22%)
Similarity:178/405 - (43%) Gaps:30/405 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IISCLLLLL--------ATVSQSKTVGYDAAADRNL-LAADLYNAVAADHLNENVVISPATIQSS 59
            :.:|||.|.        |:.::|.. .:...|..|: .|.:||..:.|.:.::|.:|||.:|  |
  Rat     5 LYTCLLWLCTSGLWTAQASTNESSN-SHRGLAPTNVDFAFNLYQRLVALNPDKNTLISPVSI--S 66

  Fly    60 MALAFVG-AKGQTASELQQGLRLGPGDADAVSQRSGSYQQALTRDNN----FRLANNIYINENLE 119
            ||||.|. ...||.|....|..| ...::|...:|..|...|.:.::    ..:.|.:::.:.|:
  Rat    67 MALAMVSLGSAQTQSLQSLGFNL-TETSEAEIHQSFQYLNYLLKQSDTGLEMNMGNAMFLLQKLK 130

  Fly   120 FKGSFRDVAQRQFDSNIDKLDFHPPYNKRTADGINRAVATKTNGKITDILRAELLNDRTEGVIVN 184
            .|.||....::.::|....:||. .:.| .:..||:.|..||.|||..:...  |:.....::||
  Rat   131 LKDSFLADVKQYYESEALAIDFE-DWTK-ASQQINQHVKDKTQGKIEHVFSD--LDSPASFILVN 191

  Fly   185 GVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSM 249
            .:.....|:..|..:.|.:..|......:|||..|....:..|...:....:::::.|.. :.:.
  Rat   192 YIFLRGIWELPFSPENTREEDFYVNETSTVKVPMMVQSGSIGYFRDSVFPCQLIQMDYVG-NGTA 255

  Fly   250 LLLLPNRKDGLRSLQQSLSGKNLLAEIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSR 314
            ..:||::.. :.::..:||...:......|:.::|.:.:||||::....|:...:.|.:..:.:.
  Rat   256 FFILPDQGQ-MDTVIAALSRDTIDRWGKLMTPRQVNLYIPKFSISDTYDLKDMLEDLNIKDLLTN 319

  Fly   315 DGDF-GNMYRMFVSHFINAVEHKANVEVTEAGVDQPLETGLLKGLFSRSKKFEADHPFVFAI--K 376
            ..|| ||...:.::   ..:.|||.:::.|..|......|....|.|.....:.:.||:..:  |
  Rat   320 QSDFSGNTKDVPLT---LTMVHKAMLQLDEGNVLPNSTNGAPLHLRSEPLDIKFNKPFILLLFDK 381

  Fly   377 YKDSIAFIGHIANYA 391
            :..|...:..:.|.|
  Rat   382 FTWSSLMMSQVVNPA 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 83/365 (23%)
Serpina6NP_001009663.1 alpha-1-antitrypsin_like 37..392 CDD:239011 83/366 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.