DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinh1

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_058869.2 Gene:Serpinh1 / 29345 RGDID:69302 Length:417 Species:Rattus norvegicus


Alignment Length:406 Identity:102/406 - (25%)
Similarity:184/406 - (45%) Gaps:35/406 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CLLLLLATVSQSKTVGYDA-------------AADRNL-LAADLYNAVAADHLNENVVISPATIQ 57
            |||.:.......|.|...|             .|:|:. ||..||.|:|.|...||:::||..:.
  Rat    10 CLLAVALAAEVKKPVEATAPGTAEKLSSKATTLAERSTGLAFSLYQAMAKDQAVENILLSPLVVA 74

  Fly    58 SSMALAFVGAKGQTASELQQGLRLGPGDADAVSQRSGSYQQALT----RDNNFRLANNIYINENL 118
            ||:.|..:|.|..|||:.:..|.......:.|....|...::|:    |:..::|.:.:|...::
  Rat    75 SSLGLVSLGGKATTASQAKAVLSAEKLRDEEVHTGLGELLRSLSNSTARNVTWKLGSRLYGPSSV 139

  Fly   119 EFKGSFRDVAQRQFDSNIDKLDFHPPYNKRTA-DGINRAVATKTNGKITDILRAELLNDRTEG-V 181
            .|...|...:::.::....|::|.   :||:| ..||...:..|:||:.::.:..   :||:| :
  Rat   140 SFADDFVRSSKQHYNCEHSKINFR---DKRSALQSINEWASQTTDGKLPEVTKDV---ERTDGAL 198

  Fly   182 IVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPD 246
            :||.:.:...|.:.|.....:.|.|......:|.|..|.....:||.:......::||:|..:..
  Rat   199 LVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMMHRTGLYNYYDDEKEKLQLVEMPLAHKL 263

  Fly   247 FSMLLLLPNRKDGLRSLQQSLSGKNLLAEIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTM 311
            .|:::|:|:..:.|..|::.|:.:.|...:|.|.::.|.:.|||..|.....|:.....||:...
  Rat   264 SSLIILMPHHVEPLERLEKLLTKEQLKTWMGKMQKKAVAISLPKGVVEVTHDLQKHLAGLGLTEA 328

  Fly   312 FSRDGDFGNMYRMFVSH--FINAVEHKANVEVTEAGVDQPLETGLLKGLFSRSKK-FEADHPFVF 373
            .  |.:..::.||....  ::.:|.|....|....|  .|.:..:......||.| |.|||||:|
  Rat   329 I--DKNKADLSRMSGKKDLYLASVFHATAFEWDTEG--NPFDQDIYGREELRSPKLFYADHPFIF 389

  Fly   374 AIK--YKDSIAFIGHI 387
            .::  ...|:.|||.:
  Rat   390 LVRDNQSGSLLFIGRL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 94/368 (26%)
Serpinh1NP_058869.2 serpinH1_CBP1 35..416 CDD:381003 96/381 (25%)
Prevents secretion from ER. /evidence=ECO:0000305 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.