DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinb6e

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:372 Identity:100/372 - (26%)
Similarity:179/372 - (48%) Gaps:34/372 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRL----GPGDADAVSQRSGSYQQAL 100
            |..:..::||..||.::.||:::..:||.|.|||::.:.|.|    |.|..|.    ...:|..|
  Rat    18 VLGEDSSKNVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYNCNGNGGGDF----HQCFQSLL 78

  Fly   101 TRDNN------FRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFH-PPYNKRTADGINRAVA 158
            |..|.      .:.:|::::.::.|...||:|..::.:::.|:.:||. .|...|  ..||..||
  Rat    79 TEVNKSDRRHMLKTSNSVFVEDSFEILASFKDSCRKFYEAEIENMDFKGAPEQSR--QHINTWVA 141

  Fly   159 TKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWTLQ 223
            .||...|.::|....:|..|:.|::|...:...|:|.|..:.|.:..|:....:...|..|:...
  Rat   142 KKTEDVIRELLSPGTVNSNTQLVLMNSFYFKGNWEKPFNKEDTREMPFKVSKNEKKIVQMMFNKS 206

  Fly   224 NFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKNLL--AEIGAMSQQKVEV 286
            ||....|..:...:..|||.....|:.::||:....||:::..::.:.|:  ..:..|.:::||:
  Rat   207 NFRTYHVEDISTTLALLPYLGNQLSITIMLPDEYVELRTVENQITYEKLIEWTRLENMQEEEVEI 271

  Fly   287 LLPKFSVTFGLGLEGPFKKLGVHTMFSRDG--DFGNMYRMFVSH----FINAVEHKANVEVTEAG 345
            |||:|.:.....::....|||:...| .||  ||..     :|.    |::.|.||:.|||.|.|
  Rat   272 LLPRFKLEESYDMKNVLCKLGMTNAF-EDGRADFSG-----ISSKPGLFLSKVVHKSVVEVNEEG 330

  Fly   346 VDQPLETGLL-KGLFSRSKKFEADHPFVFAIK--YKDSIAFIGHIAN 389
            .:....|.:: .|.....:...|||||:|.|:  ...:|.|:|..::
  Rat   331 TEAAAPTEIVTMGSPLSPQCLVADHPFLFLIQDDRNKAILFLGRFSS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 100/368 (27%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.