DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinb6a

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_006253933.1 Gene:Serpinb6a / 291085 RGDID:735108 Length:400 Species:Rattus norvegicus


Alignment Length:389 Identity:101/389 - (25%)
Similarity:183/389 - (47%) Gaps:42/389 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YNAVAADHLNE-------------------NVVISPATIQSSMALAFVGAKGQTASELQQGLRL- 81
            |.....|||.|                   |:.:||.:|.:::.:.|:||||.|||::.|.|.| 
  Rat    17 YRFTIMDHLQEGNGIFALKLLKTLSEDSSNNIFLSPISISAALTMVFMGAKGMTASQMVQTLSLD 81

  Fly    82 ---GPGDADAVSQRSGSYQQALTRDNN------FRLANNIYINENLEFKGSFRDVAQRQFDSNID 137
               |.|..| |.|   .:|..|...|.      .:.||.::..:..:...||:|..::.:::.::
  Rat    82 KCSGNGGGD-VHQ---GFQSLLAEVNKTGTQYLLKTANRLFGEKTCDILASFKDACRKFYEAEME 142

  Fly   138 KLDFHPPYNKRTADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTE 202
            :|||... .:::...||..||.||..||.::|...:::..|..|:||.:.:...|.|.|..:.|.
  Rat   143 ELDFKGD-TEQSRQRINTWVAKKTEDKIKELLAPGIVDPDTVLVLVNAIYFKGNWDKQFNKEHTR 206

  Fly   203 KRSFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSL 267
            ::.|:....:...|..|:....|....:..:..|::.|||...:.:|:::||:....|:::::.|
  Rat   207 EKPFKVSKTEEKPVQMMFMKSTFKMTYIGEIFTKILLLPYAGNELNMIIMLPDEHIELKTVEKEL 271

  Fly   268 SGKNLL--AEIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRD-GDFGNMYRMFVSHF 329
            :.:..:  ..:..:.:::|||.||:|.:.....::....|||:...|... .||..:... ...|
  Rat   272 TYEKFIEWTRLDMLDEEEVEVFLPRFKLEENYDMKVVLGKLGMTDAFMEGRADFSGIASK-QGLF 335

  Fly   330 INAVEHKANVEVTEAGVDQPLETG--LLKGLFSRSKKFEADHPFVFAIKY--KDSIAFIGHIAN 389
            ::.|.|||.|||.|.|.:....||  :.......:.:|.|||||:|.|::  ...|.|.|..::
  Rat   336 LSKVIHKAFVEVNEEGTEAVAATGSTITMRCLRFTPRFLADHPFLFFIQHVKTKGILFCGRFSS 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 101/385 (26%)
Serpinb6aXP_006253933.1 SERPIN 25..400 CDD:294093 98/381 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.