DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinf2

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001011892.1 Gene:Serpinf2 / 287527 RGDID:1306692 Length:491 Species:Rattus norvegicus


Alignment Length:378 Identity:95/378 - (25%)
Similarity:166/378 - (43%) Gaps:57/378 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGDADAVSQRSGSYQQA 99
            ||::.||....:.|:|:||.::..:::...:||:.||...||:.|.:..|  ..:......:.|.
  Rat    92 DLFSLVAQTSTSSNLVLSPLSVALALSHLALGARNQTLENLQRVLHMNMG--SCIPHLLSHFCQN 154

  Fly   100 LTRDNNFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRTAD--GINRAVATKTN 162
            | .....|||..||:.:....|..|.:.:::.|.:...||.     .::..|  .||:.|...|.
  Rat   155 L-NPGTIRLAARIYLQKGFPIKDDFLEQSEKLFGAKPVKLT-----GRQEEDLMNINKWVKEATE 213

  Fly   163 GKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTM-------- 219
            |||.|.|..  |.|.|..:::|.:.:...|:..|....|:|.||......:|.|..|        
  Rat   214 GKIEDFLSE--LPDNTVLLLLNAIHFHGFWRTKFDPSLTQKDSFHLDEQFTVPVAMMHAQSYPLR 276

  Fly   220 WTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKN---LLAEI----- 276
            |.|       :...:.:|...|:|| :.|.::::|           :..|.|   :||.:     
  Rat   277 WFL-------LEQPEIQVAHFPFQN-NMSFVVIMP-----------TYFGWNVSEVLANLTWDTL 322

  Fly   277 --GAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRDGDFGNMYRMFVSHFINAVEHKANV 339
              .:|.::..:|.|||..:...|.|.....|||:..:|......|...:..|   :::|:|::.:
  Rat   323 YQPSMREKPTKVRLPKLHLEQHLDLVATLSKLGLQDLFQSPDLRGISDQSLV---VSSVQHQSTM 384

  Fly   340 EVTEAGVDQPLETGLLKGLFSRSKKFEADHPFVFAIKYKDSIA---FIGHIAN 389
            |::||||:....|.......|.| .|..:.||:|.| .:::|.   |:|.:.|
  Rat   385 ELSEAGVEAAAATSTAMTRMSLS-SFFLNRPFIFFI-MEETIGIPLFVGSVRN 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 94/374 (25%)
Serpinf2NP_001011892.1 alpha2AP 82..433 CDD:239008 94/374 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.