DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinb10

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_714955.2 Gene:Serpinb10 / 266775 RGDID:628853 Length:397 Species:Rattus norvegicus


Alignment Length:401 Identity:108/401 - (26%)
Similarity:187/401 - (46%) Gaps:54/401 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AADRNLLAADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGL--------RLG 82
            |...|..|.:....:|......|:..||..|.:|:|:.::|.||.||:::.|.|        :.|
  Rat     5 AVSINQFAVEFSKKLAESAEGRNIFFSPWGISTSLAMVYLGTKGTTAAQMSQVLHFGSIQDFKFG 69

  Fly    83 PGDADAVSQR-----SGSYQ------QALT-----RDNNF--RLANNIYINENLEFKGSFRDVAQ 129
            |   |:..:|     ||..:      |.||     ..|::  ::||.||:.:...|...:.:..:
  Rat    70 P---DSEKKRKMECHSGKSEEIQSDFQTLTAKILKHGNSYVLKIANRIYVEKTYLFHNKYLEDMK 131

  Fly   130 RQFDSNIDKLDFHPPYNKRTADG-----INRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYS 189
            ..|.:....::|      ..|.|     ||..|.::|.|||.::|..:.::::|..|:||.:.:.
  Rat   132 TYFGAEPQSVNF------VEASGQIRKEINSWVGSQTGGKIPNLLPDDAVDNKTTMVLVNALYFK 190

  Fly   190 AAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLP 254
            ..|:..|.:..|.:|.||.....|..|..|...|:.....:..|....|:|.|||.:||:|||||
  Rat   191 GTWEHQFSVQNTTERPFRINKTTSKPVQMMSMKQSLQVFHIEELQTIGVQLHYQNREFSLLLLLP 255

  Fly   255 NRKDGLRSLQQSLSGKNL--LAEIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSR-DG 316
            ...:||:.|:::::.:.|  ......|...:|::.||||.:.....|:...:.:|:...|:: ..
  Rat   256 EEVEGLKQLERAITYEKLDKWTSADMMDTYEVQLYLPKFKMEESYDLQSALRDMGMTDAFNQGKA 320

  Fly   317 DFGNM---YRMFVSHFINAVEHKANVEVTEAGVDQPLETGLLKGLFSRSKKFE--ADHPFVFAIK 376
            :|.||   ..:|:|:    |.||..:|:.|.|.:....||.......::...|  |||||:|.|:
  Rat   321 NFSNMTSERNLFLSN----VFHKTFLEINEEGTEAAAGTGSEVNFRIKAPSIELNADHPFLFLIR 381

  Fly   377 YK--DSIAFIG 385
            :.  ::|.|.|
  Rat   382 HNVTNTILFYG 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 107/397 (27%)
Serpinb10NP_714955.2 SERPIN 4..397 CDD:294093 108/401 (27%)
Nuclear localization signal. /evidence=ECO:0000250 74..77 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.