DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and SERPINA11

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001073920.1 Gene:SERPINA11 / 256394 HGNCID:19193 Length:422 Species:Homo sapiens


Alignment Length:374 Identity:86/374 - (22%)
Similarity:172/374 - (45%) Gaps:30/374 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLG---PGDADAVSQ--R 92
            |..||..:||| ...|:..||.:|.:::||..:||:..|::.:.:||...   ..:|| :.|  |
Human    58 ALRLYKELAAD-APGNIFFSPVSISTTLALLSLGAQANTSALILEGLGFNLTETPEAD-IHQGFR 120

  Fly    93 SGSYQQALTRDN-NFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRTADGINRA 156
            |..:..||.... ..::.|::::::.|:.:..:.|..:..:.:.....:|..  :..|...||..
Human   121 SLLHTLALPSPKLELKVGNSLFLDKRLKPRQHYLDSIKELYGAFAFSANFTD--SVTTGRQINDY 183

  Fly   157 VATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKR-SFRTGSGQSVKVDTMW 220
            :..:|.|::.|.| .|...| |..|:.|.:.:.|.|:..|...:|:|: ||......|::|..|.
Human   184 LRRQTYGQVVDCL-PEFSQD-TFMVLANYIFFKAKWKHPFSRYQTQKQESFFVDERTSLQVPMMH 246

  Fly   221 TLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKNLLAEIGAMSQQKVE 285
            ..:...:.....|...|:::.|:....::|:|....|  ::.::.:|..:.|......:....::
Human   247 QKEMHRFLYDQDLACTVLQIEYRGNALALLVLPDPGK--MKQVEAALQPQTLRKWGQLLLPSLLD 309

  Fly   286 VLLPKFSVTFGLGLEGPFKKLGVHTMFSRDGDFGNMYRMFVSHFINAVEHKANVEVTEAGVDQPL 350
            :.||:||::....||....::|:..:.:.:.||..:... ::..|:.|.|||.|:::|.|.    
Human   310 LHLPRFSISGTYNLEDILPQIGLTNILNLEADFSGVTGQ-LNKTISKVSHKAMVDMSEKGT---- 369

  Fly   351 ETGLLKGLFSRSKKFEA--------DHPFVFAI--KYKDSIAFIGHIAN 389
            |.|...||.|:......        :.||:..:  ....|:.|:|.:.|
Human   370 EAGAASGLLSQPPSLNTMSDPHAHFNRPFLLLLWEVTTQSLLFLGKVVN 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 85/370 (23%)
SERPINA11NP_001073920.1 alpha-1-antitrypsin_like 53..416 CDD:239011 85/370 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.