DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinb10

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_006529660.1 Gene:Serpinb10 / 241197 MGIID:2138648 Length:382 Species:Mus musculus


Alignment Length:283 Identity:72/283 - (25%)
Similarity:124/283 - (43%) Gaps:45/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LAFVGAKGQTASELQQGLRLGPGD-----ADAVSQR-----SGSYQ-----------QALTRDNN 105
            :.::|.||.||.::.|.|:....:     .|:..:|     ||.::           :.|...|:
Mouse     1 MVYLGTKGTTADQMAQVLQFSSVEDFKSCPDSEKKRKMEFNSGKFEEIQSDFQTLAAEILKPGNS 65

  Fly   106 F--RLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRTADG-----INRAVATKTNG 163
            :  :.||.||..:...|...:.:..:..|.:....::|      ..|.|     ||..|.::|.|
Mouse    66 YVLKTANRIYGEKTYPFHNKYLEDMKTYFGAEPQSVNF------VEASGQIRKEINSWVGSQTGG 124

  Fly   164 KITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWTLQNFNYA 228
            ||.::|..:.::.:|:.|:||.:.:...|:..|.:..|.:|.||.....|..|..|...|:....
Mouse   125 KIPNLLPDDSVDTKTKMVLVNALYFKGTWEHQFSVKSTTERPFRVNKTTSKPVQMMSMKQSLQVF 189

  Fly   229 EVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKNL--LAEIGAMSQQKVEVLLPKF 291
            .:..|....::|.|||.|.|:|||||...|||..|:::::.:.|  ......|...:|::.||||
Mouse   190 HIEELQTIGLQLHYQNRDLSLLLLLPEAIDGLEQLERAITYEKLDKWTSADMMDTYEVQLYLPKF 254

  Fly   292 ---------SVTFGLGLEGPFKK 305
                     |...|....||:.|
Mouse   255 KMEESYDLKSALRGQKFSGPYSK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 72/283 (25%)
Serpinb10XP_006529660.1 serpin 1..>277 CDD:393296 71/281 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.