DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpina3f

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001028507.2 Gene:Serpina3f / 238393 MGIID:2182838 Length:445 Species:Mus musculus


Alignment Length:389 Identity:104/389 - (26%)
Similarity:171/389 - (43%) Gaps:53/389 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AADRNLLAADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGDA---- 86
            |:.....|..||..:...:.:||||.||.:|.:::||..:|||..|..|:.:||:....:.    
Mouse    38 ASSNTDFAFSLYKELVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGLKFNLTETPEPD 102

  Fly    87 ---------DAVSQRSGSYQQALTRDNNFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFH 142
                     |.:|| .|:..|..|       .:.::|.::|:....|::.|:..:.:.....||.
Mouse   103 IHQGFRYLLDLLSQ-PGNQVQIST-------GSALFIEKHLQILAEFKEKARALYQAEAFTADFQ 159

  Fly   143 PPYNKRTADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFR 207
            .|......  ||..|:..|.|||.:::..  |:.||..|:||.:.:...|:..|..|.|.|..|.
Mouse   160 QPLEATKL--INDYVSNHTQGKIKELISD--LDKRTLMVLVNYIYFKGKWEMPFDPDDTCKSEFY 220

  Fly   208 TGSGQSVKVDTMWTLQNFN--YAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGK 270
            ....:|||| .|..:.|..  |.....|...||||.|.. :.|.:.:||: :..::.::.||..:
Mouse   221 LDENRSVKV-PMMKINNLTTPYFRDEELSCTVVELKYTG-NASAMFILPD-QGKMQQVEASLQPE 282

  Fly   271 NLLAEIGAMSQQKV-EVLLPKFSVTFGLGLEGPFKKLGVHTMFSRDGDFGNM-----YRMFVSHF 329
            .|.....::..:.: |:.|||||::....||....:||:..:||...|...:     .|      
Mouse   283 TLRNWKDSLKPRLINELCLPKFSISTDYSLEHILPELGIRELFSTQADLSAITGTKDLR------ 341

  Fly   330 INAVEHKANVEVTEAGVDQPLETG-----LLKGLFSRSKKFEADHPFVFAIKYKDSIAFIGHIA 388
            .:.|.|||.::|.|.|.:....||     ..:|:. .|.|...|.||:..|...::     |||
Mouse   342 TSQVVHKAVLDVAETGTEAAAGTGYQNLQCCQGVI-YSMKIYFDRPFLMIISDTNT-----HIA 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 100/382 (26%)
Serpina3fNP_001028507.2 alpha-1-antitrypsin_like 40..405 CDD:239011 103/387 (27%)
RCL 357..382 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.