DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinb9b

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_035582.1 Gene:Serpinb9b / 20706 MGIID:894668 Length:377 Species:Mus musculus


Alignment Length:391 Identity:104/391 - (26%)
Similarity:182/391 - (46%) Gaps:61/391 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NAVAADHL---------NENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGDADAVSQRS 93
            |...|.||         ::||..||.:|.|::|:..:|||.|||.::.|.|.|        .:..
Mouse     8 NGTFAIHLLKMLCQSNPSKNVCFSPVSISSALAMVLLGAKEQTAVQISQALGL--------KKEK 64

  Fly    94 GSYQQAL---------TRDNNFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRT 149
            |.:|..|         .|..:..:||.::.::..|...:|::...|.:||.:::::|.    |..
Mouse    65 GIHQGFLKLLRKLNKPDRKYSLIVANRLFADKTCEVLQTFKESCFRFYDSEMEQVNFF----KAA 125

  Fly   150 ADG---INRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSG 211
            .:.   ||..|:.:|.|||.::|..:.:|.:|..|:||.:.:...|...|..:.|.:..|.....
Mouse   126 VESRQCINTWVSKQTEGKIPELLADDSVNFQTRLVLVNALYFKGMWACQFCKESTREMPFYINKD 190

  Fly   212 QSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKNLLA-- 274
            :...|..|.....|.:|.|:.|.|:::.:||:..:.|:::|||.:...|..::..|:.:.|:|  
Mouse   191 EKRPVQMMCQTDTFMFAFVDELPARLLIMPYEGMELSLMVLLPEKGVDLSKVENDLTFEKLIAWT 255

  Fly   275 EIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRD-GDFGNM---YRMFVSHFINAVEH 335
            :...|...:|:|.||||.:.....::...:.||:..:|.:: .|...|   ..:.:|.||    |
Mouse   256 KPDIMWSTEVKVFLPKFKLQEDYEMKSVLQCLGIVDVFEKEKADLSAMSPERNLCLSKFI----H 316

  Fly   336 KANVEVTEAGVDQ----------PLETGLLKGLFSRSKKFEADHPFVFAIKYK--DSIAFIGHIA 388
            |:.|||.|.|.:.          ||..|      .....|.|||||:|.|::.  :||.|.|..:
Mouse   317 KSVVEVNEEGTEAAAASSAEGIIPLCLG------GGPSWFCADHPFLFFIRHNQTNSILFCGRFS 375

  Fly   389 N 389
            :
Mouse   376 S 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 104/387 (27%)
Serpinb9bNP_035582.1 SERPIN 4..377 CDD:294093 104/391 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.