DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinf2

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_032904.1 Gene:Serpinf2 / 18816 MGIID:107173 Length:491 Species:Mus musculus


Alignment Length:369 Identity:92/369 - (24%)
Similarity:166/369 - (44%) Gaps:39/369 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGDADAVSQRSGSYQQA 99
            ||::.||....:.|:|:||.::..:::...:||:.||...|.:.|.:..|  ..:......:.|.
Mouse    92 DLFSLVAQTSTSSNLVLSPLSVALALSHLALGAQNQTLHSLHRVLHMNTG--SCLPHLLSHFYQN 154

  Fly   100 LTRDNNFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRTAD--GINRAVATKTN 162
            | .....|||..||:.:....|..|.:.::|.|.:...||.     .|:..|  .||:.|...|.
Mouse   155 L-GPGTIRLAARIYLQKGFPIKDDFLEQSERLFGAKPVKLT-----GKQEEDLANINQWVKEATE 213

  Fly   163 GKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTM-------- 219
            |||.|.|..  |.|.|..:::|.:.:...|:..|....|:|..|......:|.||.|        
Mouse   214 GKIEDFLSE--LPDSTVLLLLNAIHFHGFWRTKFDPSLTQKDFFHLDERFTVSVDMMHAVSYPLR 276

  Fly   220 WTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKD-GLRSLQQSLSGKNLLAEIGAMSQQK 283
            |.|       :...:.:|...|::| :.|.::::|...: .:..:..:|:...|...  ::.::.
Mouse   277 WFL-------LEQPEIQVAHFPFKN-NMSFVVVMPTYFEWNVSEVLANLTWDTLYHP--SLQERP 331

  Fly   284 VEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRDGDFGNMYRMFVSHFINAVEHKANVEVTEAGVDQ 348
            .:|.|||..:...|.|.....:||:..:|......|...:..|   :::|:|::.:|::||||:.
Mouse   332 TKVWLPKLHLQQQLDLVATLSQLGLQELFQGPDLRGISEQNLV---VSSVQHQSTMELSEAGVEA 393

  Fly   349 PLETGLLKGLFSRSKKFEADHPFVFAIKYKDSIA---FIGHIAN 389
            ...|.:.....|.| .|..:.||:|.| .:|:|.   |:|.:.|
Mouse   394 AAATSVAMNRMSLS-SFTVNRPFLFFI-MEDTIGVPLFVGSVRN 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 91/365 (25%)
Serpinf2NP_032904.1 alpha2AP 82..433 CDD:239008 91/365 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..491
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.