DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and SERPINA12

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:407 Identity:93/407 - (22%)
Similarity:172/407 - (42%) Gaps:89/407 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ADRNL-LAADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQG------------ 78
            |.:|: |...|...:|..:...|:.:||.:|.::.::..:||:..|..|::||            
Human    49 ARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLH 113

  Fly    79 ----------------LRLGPGDADAVSQRSGSYQQALTRDNNFRLANNIYIN-ENLEFKGSFRD 126
                            |:|..|:...:.||....::.|....||..|..|..| :|||       
Human   114 EGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLE------- 171

  Fly   127 VAQRQFDSNIDKLDFHPPYNKRTADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAA 191
            :||:|                     ||..::.||:|||.:::  |.::..|..::.|.:.:.|.
Human   172 MAQKQ---------------------INDFISQKTHGKINNLI--ENIDPGTVMLLANYIFFRAR 213

  Fly   192 WQKAFRLDKTEKRSFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNR 256
            |:..|..:.|::..|......||||..|:....:.....:.|...::|:|||. :.:.:.:||: 
Human   214 WKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQK-NITAIFILPD- 276

  Fly   257 KDGLRSLQQSLSGKNLLAEIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRDGDFGNM 321
            :..|:.|::.|...........:|::.|:|.:|:..:|....|:.....:||..:|...||...:
Human   277 EGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKI 341

  Fly   322 --YRMFVSHFINAVEHKANVEVTEAGVD---------QPLETGLLKGLFSRSKKFEADHPFVFAI 375
              :|   |..:....|||.:::.|.|.:         .|:||.|:         .:.|.|::..|
Human   342 APHR---SLKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPLV---------VKIDKPYLLLI 394

  Fly   376 KYKD---SIAFIGHIAN 389
             |.:   |:.|:|.|.|
Human   395 -YSEKIPSVLFLGKIVN 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 90/400 (23%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 93/407 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.