DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ab and Serpinb7

DIOPT Version :9

Sequence 1:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_569088.1 Gene:Serpinb7 / 117092 RGDID:71063 Length:380 Species:Rattus norvegicus


Alignment Length:374 Identity:99/374 - (26%)
Similarity:175/374 - (46%) Gaps:29/374 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLR-LGPGDADAVSQRSGSYQQ 98
            ||:..:.:...|.||..|..:|.::::|..:||:|..|.::.:.|. :.|......|......|.
  Rat    14 DLFREMDSSQGNGNVFFSSLSIFTALSLIRLGARGDCARQIDKALHFISPSRQGNSSNSQLGLQY 78

  Fly    99 ALTR----------DNNFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRTADGI 153
            .|.|          |....:||.::..:..:|..|:.:.|:..:::.::::||.... :.|...|
  Rat    79 QLKRVLADINSSHKDYELSIANGVFAEKVFDFHKSYMECAENLYNAKVERVDFTNDI-QETRFKI 142

  Fly   154 NRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDT 218
            |:.:..:|:|||..:|....|:.....|:||.|.:...|:.||....|....||:.||....|:.
  Rat   143 NKWIENETHGKIKKVLGDSSLSSSAVMVLVNAVYFKGKWKSAFTKSDTLSCHFRSPSGPGKAVNM 207

  Fly   219 MWTLQNFNYAEVNSLDAKVVELPYQNPDFSMLLLLPNRKDGLRSLQQSLSGKNLL--AEIGAMSQ 281
            |...:.||.:.:.....:::||.|.. ..||.::||  :|.|..::..||.:||:  .....|..
  Rat   208 MHQERRFNLSTIQEPPMQILELQYHG-GISMYIMLP--EDDLSEIESKLSFQNLMDWTNSRKMKS 269

  Fly   282 QKVEVLLPKFSVTFGLGLEGPFKKLGVHTMF--SRDGDFGNMY---RMFVSHFINAVEHKANVEV 341
            |.|.|.||:|.:.....:....|.:|:..:|  || .|...:.   |::||..:    ||:.:||
  Rat   270 QYVNVFLPQFKIEKDYEMRSHLKSVGLEDIFVESR-ADLSGIASGGRLYVSKLM----HKSLIEV 329

  Fly   342 TEAGVD--QPLETGLLKGLFSRSKKFEADHPFVFAIKYKDSIAFIGHIA 388
            :|.|.:  ...|:.:::.|...|..|.||.||:|.|:....|.|.|.::
  Rat   330 SEEGTEATAATESNIVEKLLPESTVFRADRPFLFVIRKNGIILFTGKVS 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 99/371 (27%)
Serpinb7NP_569088.1 SERPIN 4..380 CDD:294093 99/374 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.