DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and HMGB3

DIOPT Version :10

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001031075.1 Gene:HMGB3 / 838659 AraportID:AT1G20696 Length:147 Species:Arabidopsis thaliana


Alignment Length:136 Identity:34/136 - (25%)
Similarity:66/136 - (48%) Gaps:19/136 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LKAEQKKAQGQGGRKEDERITTAVMKVLEGYDWNLVQASAKAPTDRKKEHIKRPMNAFMVWAQAA 91
            :|..:.||:.:..:      .:...|..:|     .:.:||.|...     |||.:||.|:.:..
plant     1 MKGAKSKAETRSTK------LSVTKKPAKG-----AKGAAKDPNKP-----KRPSSAFFVFMEDF 49

  Fly    92 RRVMSKQYPHLQN-SELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDY--KYQPRRKKA 153
            |....:::|..:: :.:.|:.|:.||:|.||:|.|::..|:|.::.:::....|  |.....:|.
plant    50 RVTYKEEHPKNKSVAAVGKAGGEKWKSLSDSEKAPYVAKADKRKVEYEKNMKAYNKKLVIALRKM 114

  Fly   154 RVLPSQ 159
            |.|.||
plant   115 RNLTSQ 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 HMG-box_SoxE 76..150 CDD:438840 21/76 (28%)
HMGB3NP_001031075.1 HMG-box_AtHMGB1-like 36..96 CDD:438821 19/59 (32%)

Return to query results.
Submit another query.