DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and HMGB1

DIOPT Version :10

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_974413.1 Gene:HMGB1 / 824351 AraportID:AT3G51880 Length:185 Species:Arabidopsis thaliana


Alignment Length:124 Identity:32/124 - (25%)
Similarity:61/124 - (49%) Gaps:15/124 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KKAQGQGGRKEDERITTAVMKVLEGYDWNLVQASAKAPTDR--------KKE--HIKRPMNAFMV 86
            |.|:|    |:..:.|...:|.::.......:|.|:.||.|        ||:  ..||..:||.|
plant     2 KTAKG----KDKVKTTKEALKPVDDRKVGKRKAPAEKPTKRETRKEKKAKKDPNKPKRAPSAFFV 62

  Fly    87 WAQAARRVMSKQYPHLQN-SELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDY 144
            :.:..|....|:.|:::. |.:.|:.|:.||::..::|.|:.|.|.|.:..::::...|
plant    63 FLEDFRVTFKKENPNVKAVSAVGKAGGQKWKSMSQAEKAPYEEKAAKRKAEYEKQMDAY 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 HMG-box_SoxE 76..150 CDD:438840 19/70 (27%)
HMGB1NP_974413.1 PRK05901 1..>171 CDD:235640 32/124 (26%)
HMG-box_AtHMGB1-like 54..114 CDD:438821 18/59 (31%)

Return to query results.
Submit another query.