DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and Sox12

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001162121.1 Gene:Sox12 / 689988 RGDID:1586313 Length:314 Species:Rattus norvegicus


Alignment Length:319 Identity:98/319 - (30%)
Similarity:133/319 - (41%) Gaps:81/319 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KAPTDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAE 131
            |.|:.    ||||||||||||:|..||.:..|:|.:.|:|:||.||:.|:.|:||:|.||:..||
  Rat    34 KTPSG----HIKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAE 94

  Fly   132 KLRMTHKQEHPDYKYQPRRKK----ARVLPSQQSGEGG----SPGPEMTLSATMGSSGKPRSSNS 188
            :||:.|..::|||||:||:|.    |:..|....|.||    .|||::.               .
  Rat    95 RLRLKHMADYPDYKYRPRKKSKGAPAKARPRPPGGGGGGSRLKPGPQLP---------------G 144

  Fly   189 NGQRRAGKGNAAADLGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIET-GLDS 252
            .|.|||..|    .||..|:       .....|....|            .|:|..|:|| |.:.
  Rat   145 RGGRRATGG----PLGGGAA-------APEDDDEDEEE------------ELLEVRLLETPGREL 186

  Fly   253 PCSTASSMSSLTPPATPYNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREYVAIG 317
            .....:..::..|.......:...|.||||   |..|.:..||            |...|..|..
  Rat   187 WRMVPAGRAARGPAERAQGPSSEGAAASAA---SPTLSEDEEP------------EEEEEEAATA 236

  Fly   318 EVNYQGQSAGVQSGAEGGGAGQEMDFLENINGYGGYTGSRVSY----PAYSYPANGGHF 372
            |   :|:...|.||.|      .:.||..:.  .|.||...|.    |....|:...||
  Rat   237 E---EGEEETVASGEE------PLGFLSRMP--PGPTGLDCSALDRDPDLLPPSGTSHF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 38/69 (55%)
Sox12NP_001162121.1 SOX-TCF_HMG-box 39..110 CDD:238684 39/70 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342401
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.