DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Sox100B and SRY

DIOPT Version :9

Sequence 1:	NP_651839.1	Gene:	Sox100B / 45039	FlyBaseID:	FBgn0024288	Length:	529	Species:	Drosophila melanogaster
Sequence 2:	NP_003131.1	Gene:	SRY / 6736	HGNCID:	11311	Length:	204	Species:	Homo sapiens

Alignment Length:	88	Identity:	42/88 - (47%)
Similarity:	67/88 - (76%)	Gaps:	1/88 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    74 KEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHK 138
            ::.:|||||||:||::..||.|:.:.|.::|||:||.||..||.|.:::|.||.:.|:||:..|:
Human    57 QDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHR 121

  Fly   139 QEHPDYKYQPRRKKARVLPSQQS 161
            :::|:|||:||| ||::||...|
Human   122 EKYPNYKYRPRR-KAKMLPKNCS 143

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Sox100B	NP_651839.1	SOX-TCF_HMG-box	76..146	CDD:238684	32/69 (46%)
SRY	NP_003131.1	Sufficient for interaction with KPNB1. /evidence=ECO:0000269\|PubMed:15297880	59..136		38/77 (49%)
		SOX-TCF_HMG-box	59..130	CDD:238684	33/70 (47%)
		Required for nuclear localization. /evidence=ECO:0000269\|PubMed:12764225, ECO:0000269\|PubMed:15746192	61..77		10/15 (67%)
		Sufficient for interaction with EP300. /evidence=ECO:0000269\|PubMed:15297880	107..139		15/32 (47%)
		Required for nuclear localization. /evidence=ECO:0000269\|PubMed:15297880	130..136		4/6 (67%)
		Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000269\|PubMed:15469996	138..155		3/6 (50%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	175..204
		Necessary for interaction with SLC9A3R2. /evidence=ECO:0000269\|PubMed:9054412	198..204
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165148470
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000028
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.840