Sequence 1: | NP_651839.1 | Gene: | Sox100B / 45039 | FlyBaseID: | FBgn0024288 | Length: | 529 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_008873.1 | Gene: | SOX15 / 6665 | HGNCID: | 11196 | Length: | 233 | Species: | Homo sapiens |
Alignment Length: | 225 | Identity: | 77/225 - (34%) |
---|---|---|---|
Similarity: | 101/225 - (44%) | Gaps: | 59/225 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 SAKAPTDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEF 129
Fly 130 AEKLRMTHKQEHPDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRA 194
Fly 195 GKGNAAAD----LGSCASTISHANV-GSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPC 254
Fly 255 STASSMSSL-----------TPPA--TPYN 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sox100B | NP_651839.1 | SOX-TCF_HMG-box | 76..146 | CDD:238684 | 37/69 (54%) |
SOX15 | NP_008873.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..48 | 3/10 (30%) | |
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000250|UniProtKB:P43267 | 1..47 | 3/9 (33%) | |||
SOX-TCF_HMG-box | 48..119 | CDD:238684 | 38/70 (54%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 113..153 | 18/57 (32%) | |||
Interaction with FHL3. /evidence=ECO:0000250|UniProtKB:P43267 | 138..183 | 11/44 (25%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 208..233 | 6/13 (46%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165148502 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000028 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.740 |