DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and SOX15

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_008873.1 Gene:SOX15 / 6665 HGNCID:11196 Length:233 Species:Homo sapiens


Alignment Length:225 Identity:77/225 - (34%)
Similarity:101/225 - (44%) Gaps:59/225 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SAKAPTDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEF 129
            |..||.....|.:||||||||||:.|.||.|::|.|.:.|||:||.||..||.|.:.:|:||:|.
Human    37 SPAAPGTLPLEKVKRPMNAFMVWSSAQRRQMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEE 101

  Fly   130 AEKLRMTHKQEHPDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRA 194
            |::||..|.:::|||||:||||      ::.||.|.|            ..|:.|.:.::|....
Human   102 AKRLRARHLRDYPDYKYRPRRK------AKSSGAGPS------------RCGQGRGNLASGGPLW 148

  Fly   195 GKGNAAAD----LGSCASTISHANV-GSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPC 254
            |.|.|...    .|....:.|.|.: ||..|.....||                       .|||
Human   149 GPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEA-----------------------PSPC 190

  Fly   255 STASSMSSL-----------TPPA--TPYN 271
            |...|...|           .||.  ||||
Human   191 SLPQSDPRLQGELLPTYTHYLPPGSPTPYN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 37/69 (54%)
SOX15NP_008873.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 3/10 (30%)
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000250|UniProtKB:P43267 1..47 3/9 (33%)
SOX-TCF_HMG-box 48..119 CDD:238684 38/70 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..153 18/57 (32%)
Interaction with FHL3. /evidence=ECO:0000250|UniProtKB:P43267 138..183 11/44 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..233 6/13 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148502
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.