DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and SOX3

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_005625.2 Gene:SOX3 / 6658 HGNCID:11199 Length:446 Species:Homo sapiens


Alignment Length:323 Identity:97/323 - (30%)
Similarity:136/323 - (42%) Gaps:89/323 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 TDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLR 134
            ||  ::.:||||||||||::..||.|:.:.|.:.|||:||.||..||.|.|::|:||::.|::||
Human   134 TD--QDRVKRPMNAFMVWSRGQRRKMALENPKMHNSEISKRLGADWKLLTDAEKRPFIDEAKRLR 196

  Fly   135 MTHKQEHPDYKYQPRRKKARVLPSQQ-SGEGG--SPGPEMTLSATMGSSGKPRSSNSNGQRRAGK 196
            ..|.:|:|||||:||||...:|...: |...|  .||.....:|...::....|....|||    
Human   197 AVHMKEYPDYKYRPRRKTKTLLKKDKYSLPSGLLPPGAAAAAAAAAAAAAAASSPVGVGQR---- 257

  Fly   197 GNAAADLGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASSMS 261
                      ..|.:|.|..:|.                 |.||:::.|   |...|    .|||
Human   258 ----------LDTYTHVNGWANG-----------------AYSLVQEQL---GYAQP----PSMS 288

  Fly   262 S-LTPPATP----YNVA--------PSNAKA----SAANNPSLLLRQLSEPVANAGDGYGVLLEA 309
            | ..|||.|    |::|        |..|::    :||              |.|..|||.:..:
Human   289 SPPPPPALPPMHRYDMAGLQYSPMMPPGAQSYMNVAAA--------------AAAASGYGGMAPS 339

  Fly   310 GREYVAIGEVNYQGQSAGVQSGAEGGGAGQEMDFLENINGYGGYTGSRV-SYPAYSYPANGGH 371
            .....|..    .||.....:.|....|...:          |..||.| |.|:...||...|
Human   340 ATAAAAAA----YGQQPATAAAAAAAAAAMSL----------GPMGSVVKSEPSSPPPAIASH 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 36/69 (52%)
SOX3NP_005625.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..140 2/7 (29%)
SOX-TCF_HMG-box 138..209 CDD:238684 37/70 (53%)
SOXp 208..302 CDD:289133 33/131 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.