DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and SOX2

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_003097.1 Gene:SOX2 / 6657 HGNCID:11195 Length:317 Species:Homo sapiens


Alignment Length:310 Identity:83/310 - (26%)
Similarity:132/310 - (42%) Gaps:72/310 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QKKAQGQGGRKEDERITTAVMKVLEGYDWNLVQASAKAPTDRKKEHIKRPMNAFMVWAQAARRVM 95
            |:.:.|.||                    |...|:|........:.:||||||||||::..||.|
Human    15 QQTSGGGGG--------------------NSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKM 59

  Fly    96 SKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRRK-KARVLPSQ 159
            :::.|.:.|||:||.||..||.|.:::|:||::.|::||..|.:|||||||:|||| |..:...:
Human    60 AQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDK 124

  Fly   160 QSGEGG--SPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAAADLGSCAS----TISHANVGSN 218
            .:..||  :||                     |...|......|.||:..:    :.:|.|..||
Human   125 YTLPGGLLAPG---------------------GNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSN 168

  Fly   219 SSDVFSNEAF----MKSLNSACAASLMEQSLIETGLDSPCSTASSMSSLTPPATPYNVAPSNAKA 279
            .|.....:..    ...||:..||.:......:.       :|...:|:|...|..|.:|:.:.:
Human   169 GSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDV-------SALQYNSMTSSQTYMNGSPTYSMS 226

  Fly   280 -SAANNPSLLLRQL----------SEPVANAGDGYGVLLEAG--REYVAI 316
             |....|.:.|..:          |.||..:........:||  |:.:::
Human   227 YSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 36/69 (52%)
SOX2NP_003097.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 7/47 (15%)
SOX-TCF_HMG-box 40..111 CDD:238684 37/70 (53%)
SOXp 110..200 CDD:315092 24/110 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..266 3/22 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.