DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox1b

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001032751.1 Gene:sox1b / 562710 ZFINID:ZDB-GENE-060322-5 Length:340 Species:Danio rerio


Alignment Length:488 Identity:110/488 - (22%)
Similarity:164/488 - (33%) Gaps:220/488 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ASAKAPTDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFME 128
            :.:|...||    :||||||||||::..||.|:::.|.:.|||:||.||..||.:.:::|:||::
Zfish    28 SGSKVNQDR----VKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLMSEAEKRPFID 88

  Fly   129 FAEKLRMTHKQEHPDYKYQPRRKKARVLPSQQ--------SGEGGSPGPEMTLSATMGSSGKPRS 185
            .|::||..|.:|||||||:||||...:|...:        :|.||..|    :...||::|.   
Zfish    89 EAKRLRAMHMKEHPDYKYRPRRKTKTLLKKDKYSLAGGLLAGSGGGGG----VGLGMGAAGV--- 146

  Fly   186 SNSNGQR---RAGKGNAAADLGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIE 247
                |||   ..|.|      ||.|::.:|.|       .::|.|:...:.:|.||:.|.|    
Zfish   147 ----GQRLESPVGHG------GSTAASYAHMN-------GWTNGAYSGQVAAAAAAAAMMQ---- 190

  Fly   248 TGLDSPCSTASSMSSLTPPATPYNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGRE 312
                                                                             
Zfish   191 ----------------------------------------------------------------- 190

  Fly   313 YVAIGEVNYQGQSAGVQSGAEGGGAGQEMDFLENINGYGGYTGSRVSYPAYSYPANGGHFATEEQ 377
                     :.|.|                       ||.:.||...:       :.||      
Zfish   191 ---------EAQLA-----------------------YGQHPGSGAHH-------HHGH------ 210

  Fly   378 QQQQALQASEALNYKPAAADIDPKEIDQYFMDQMLPMTQHHHPHHTHPLHH----PLHHSPPLNS 438
                                                   |||||:..|:|.    .|.:||..||
Zfish   211 ---------------------------------------HHHPHNPQPMHRYEMTALQYSPLSNS 236

  Fly   439 SASLSSACSSASSQQPVAEYYEHLGYSPAASSA--------SQNPNFGP------QQPYANGAAS 489
            .:.:|::.|....    ..|.:|...|.|:|.|        ...|:..|      :.|.:.....
Zfish   237 QSYMSASPSGYGG----ISYTQHQNSSVASSGAIGALGSLVKSEPSVSPPVNAHSRAPCSGDLRE 297

  Fly   490 M------TPTLGDPAPQQELQSQQQEQQHQNPS 516
            |      |...|||:.|..|.:..|..|....|
Zfish   298 MISMYLPTAEAGDPSVQSRLHAVPQHYQSSTTS 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 35/69 (51%)
sox1bNP_001032751.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 1/6 (17%)
SOX-TCF_HMG-box 36..107 CDD:238684 37/74 (50%)
SOXp 106..>198 CDD:289133 33/216 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..219 9/72 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.