DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox12

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001025449.1 Gene:sox12 / 562381 ZFINID:ZDB-GENE-040724-33 Length:355 Species:Danio rerio


Alignment Length:311 Identity:89/311 - (28%)
Similarity:132/311 - (42%) Gaps:106/311 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KAPTDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAE 131
            |.||.    ||||||||||||:|..||.:.:|:|.:.|:|:||.|||.||.|.|.:|.||::.||
Zfish    47 KTPTG----HIKRPMNAFMVWSQIERRKIMEQWPDMHNAEISKRLGKRWKLLPDYEKIPFIKEAE 107

  Fly   132 KLRMTHKQEHPDYKYQPRRKKARVLPSQQSGEGGSP---GPEMTLSATMGSSGKPRSSNSNGQRR 193
            :||:.|..::|||||:||:|          .:|.:|   |.::.:     .|.||....|:|.  
Zfish   108 RLRLKHMADYPDYKYRPRKK----------SKGSTPVKLGEKLPM-----KSSKPLPGRSSGL-- 155

  Fly   194 AGKGNAAADLGSC-------ASTISHANVGSNS----SDVFSNEAFMK-SLNS------------ 234
                       ||       ||:....|..||.    |:..|::..|. :|.|            
Zfish   156 -----------SCKGLKIKPASSKHKMNFSSNKYKSYSESMSDDDTMDVNLESPVTQQDDRNTSS 209

  Fly   235 -------ACAASLMEQSLIETGLDSPCSTASSMSSLTP----------------------PATPY 270
                   |...|..:|.:.|..:..|.|..||:.||:.                      .:||.
Zfish   210 HFVLHQQATVQSEDQQPIPELRVKVPISQTSSIQSLSSDSECQAFPESTTSEPRGSTSGRSSTPT 274

  Fly   271 NVAPSNAKASAANNPSL---LLRQLSEPV---------------ANAGDGY 303
            :.:.|:..:||.::..|   ||..:|..:               ||:|..:
Zfish   275 STSSSSLVSSACSDEELDEELLHIISNSMPMDCSTLDKDFEAFNANSGSHF 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 39/69 (57%)
sox12NP_001025449.1 SOX-TCF_HMG-box 52..123 CDD:238684 40/70 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.