DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox13

DIOPT Version :10

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001429657.1 Gene:sox13 / 555983 ZFINID:ZDB-GENE-100519-1 Length:628 Species:Danio rerio


Alignment Length:85 Identity:37/85 - (43%)
Similarity:58/85 - (68%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQE 140
            |||||||||||||:..||.:.:.:|.:.||.:||.||..||::.:.:|:|:.|...:|...|.:.
Zfish   439 HIKRPMNAFMVWAKDERRRILQAFPDMHNSSISKILGSRWKSMSNQEKQPYYEEQARLSRQHLER 503

  Fly   141 HPDYKYQPRRKKARVLPSQQ 160
            :|||||:||.|:..::..::
Zfish   504 YPDYKYKPRPKRTCIVEGRR 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 HMG-box_SoxE 76..150 CDD:438840 35/73 (48%)
sox13NP_001429657.1 None

Return to query results.
Submit another query.