DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and SOX6

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001139291.2 Gene:SOX6 / 55553 HGNCID:16421 Length:828 Species:Homo sapiens


Alignment Length:261 Identity:73/261 - (27%)
Similarity:116/261 - (44%) Gaps:33/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RKED----ERITTAVMKVLEGYDW---NLVQASAKAPTDRK-----KEHIKRPMNAFMVWAQAAR 92
            |.||    :.:..:..|:.:.|.|   ....|.|:...|.:     :.|||||||||||||:..|
Human   572 RPEDAEGSKAMNGSAAKLQQYYCWPTGGATVAEARVYRDARGRASSEPHIKRPMNAFMVWAKDER 636

  Fly    93 RVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRRKKARVLP 157
            |.:.:.:|.:.||.:||.||..||::.:.:|:|:.|...:|...|.:::|:|||:||.|:..::.
Human   637 RKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIVD 701

  Fly   158 SQQSGEG------GSPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAAADLGS------CASTI 210
            .::...|      .|...||....|:|...:...:...|....|....|....|      |:||.
Human   702 GKKLRIGEYKQLMRSRRQEMRQFFTVGQQPQIPITTGTGVVYPGAITMATTTPSPQMTSDCSSTS 766

  Fly   211 SHANVGSNSSDVFSNEAFMKSLNSACAASLM-----EQSLIETGLDSPCSTASSMSSLTPPATPY 270
            :..   ..|..|..:...||:...:.|.:.|     |..:.:...|.|.|..||.:. .|.|...
Human   767 ASP---EPSLPVIQSTYGMKTDGGSLAGNEMINGEDEMEMYDDYEDDPKSDYSSENE-APEAVSA 827

  Fly   271 N 271
            |
Human   828 N 828

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 31/69 (45%)
SOX6NP_001139291.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 753..828 18/78 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.