DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox9

DIOPT Version :10

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001016853.1 Gene:sox9 / 549607 XenbaseID:XB-GENE-1034769 Length:482 Species:Xenopus tropicalis


Alignment Length:78 Identity:20/78 - (25%)
Similarity:41/78 - (52%) Gaps:11/78 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IGTQMVGTILSMLG--HQLDDKML-KEIIDEVDADGSGELE--FEEFV--TLAARFMVEEDAEAM 87
            :|...|..:|:.|.  .::|..:| |:.||: |.:.:|::.  |.::.  |.|::..:|.|...:
 Frog    99 LGPLQVARVLAKLAEKEKVDLVLLGKQAIDD-DCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKV 162

  Fly    88 QQELK---EAFRL 97
            ::|:.   |..||
 Frog   163 EREIDGGLETLRL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 HMG-box_SoxE 76..150 CDD:438840 6/25 (24%)
sox9NP_001016853.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..66
Sox_N 22..94 CDD:463586
Dimerization (DIM). /evidence=ECO:0000250|UniProtKB:P48436 63..103 1/3 (33%)
PQA. /evidence=ECO:0000250|UniProtKB:P48436 63..103 1/3 (33%)
HMG-box_SoxE 104..178 CDD:438840 19/73 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..274 4/16 (25%)
Transactivation domain (TAM). /evidence=ECO:0000250|UniProtKB:P48436 224..308
9aaTAD 1. /evidence=ECO:0000250|UniProtKB:P48436 276..285
9aaTAD 2. /evidence=ECO:0000250|UniProtKB:P48436 291..299
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..395
Transactivation domain (TAC). /evidence=ECO:0000250|UniProtKB:P48436 366..482
9aaTAD 3. /evidence=ECO:0000250|UniProtKB:P48436 433..441
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 448..482
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.