DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox7

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001016326.1 Gene:sox7 / 549080 XenbaseID:XB-GENE-488067 Length:362 Species:Xenopus tropicalis


Alignment Length:436 Identity:107/436 - (24%)
Similarity:153/436 - (35%) Gaps:141/436 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KAPTDRKKE-HIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFA 130
            ::|.::..| .|:||||||||||:..|:.::.|.|.|.|:||||.|||.||.|..:.|:|::|.|
 Frog    31 RSPREKGSETRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALSPAQKRPYVEEA 95

  Fly   131 EKLRMTHKQEHPDYKYQPRRKK--ARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSS--NSNGQ 191
            |:||:.|.|::|:|||:|||||  .|:.....:|            ..:.|..:.::|  ::.|.
 Frog    96 ERLRVQHMQDYPNYKYRPRRKKQIKRICKRVDTG------------FLLSSLSRDQNSVPDTRGC 148

  Fly   192 RRAGK--------GNAAADLGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIET 248
            |.|.:        |:|..|:.....|.|:   ||.....:..........|...|...:||...|
 Frog   149 RTAVEKEENGGYPGSALPDMRHYRETPSN---GSKHDQTYPYGLPTPPEMSPLEAIDQDQSFYST 210

  Fly   249 GLDSPCS--------------------TASSMSSLTPPATPYNVAPSNAKASAANNPSLLLRQLS 293
                |||                    ..|.:|.:..|.|..::.|                   
 Frog   211 ----PCSEDCHPHINGAVYEYSSRSPILCSHLSQVPIPQTGSSMIP------------------- 252

  Fly   294 EPVANAGDGYGVLLEAGREYVAIGEVNYQGQSAGVQSGAEGGGAGQEMDFLENINGYGGYTGSRV 358
             ||.|....|                 |......:.                  :.|..:.|.  
 Frog   253 -PVPNCPPAY-----------------YSSTYHSIH------------------HNYHAHLGQ-- 279

  Fly   359 SYPAYSYPANGGHFATEEQQQQQALQASEALNYKPAAADIDPKEIDQYFMDQMLPMTQHHHPH-- 421
                .|.|....|:...:|..|..|           ..|:|..|.|||.      .|..|.|.  
 Frog   280 ----LSPPPEHPHYDAIDQISQAEL-----------LGDMDRNEFDQYL------NTSLHDPSEM 323

  Fly   422 --HTHPLHHPLHHSPPLNSSASLSSACSSASSQQPVAEYYEHLGYS 465
              |.|..........|  |..||.|..:.|:     |.||.....|
 Frog   324 TIHGHVQVSQASDIQP--SETSLISVLADAT-----ATYYNSYSVS 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 37/69 (54%)
sox7NP_001016326.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..41 2/9 (22%)
SOX-TCF_HMG-box 41..112 CDD:238684 38/70 (54%)
Sox17_18_mid 171..218 CDD:371880 12/53 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.