DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and SOX18

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_060889.1 Gene:SOX18 / 54345 HGNCID:11194 Length:384 Species:Homo sapiens


Alignment Length:412 Identity:115/412 - (27%)
Similarity:155/412 - (37%) Gaps:141/412 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHK 138
            :..|:||||||||||:..|:.:::|.|.|.|:.|||.|||.||.|..::|:||:|.||:||:.|.
Human    82 ESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAERLRVQHL 146

  Fly   139 QEHPDYKYQPRRK----KAR------VLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRR 193
            ::||:|||:||||    |||      :||.....:   |.||...:|                  
Human   147 RDHPNYKYRPRRKKQARKARRLEPGLLLPGLAPPQ---PPPEPFPAA------------------ 190

  Fly   194 AGKGNAAADLGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTAS 258
            :|...|..:|....:...                                     ||..|....|
Human   191 SGSARAFRELPPLGAEFD-------------------------------------GLGLPTPERS 218

  Fly   259 SMSSL--------TPPATPYNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGV-LLEAGREYV 314
            .:..|        .|||.|.:.|....:|..|  |:.|.|       :.|..||. |.||.|...
Human   219 PLDGLEPGEAAFFPPPAAPEDCALRPFRAPYA--PTELSR-------DPGGCYGAPLAEALRTAP 274

  Fly   315 AIGEVNYQGQSAGVQSGAEGGGAGQEMDFLENINGYGGYTGSRVSYPAYSYPANGGHFATEEQQQ 379
            ....:      ||:                     |.|..|:...||....|          ..:
Human   275 PAAPL------AGL---------------------YYGTLGTPGPYPGPLSP----------PPE 302

  Fly   380 QQALQASEALNYKPAA---ADIDPKEIDQYFMDQMLPMTQHHHPHHTHPLHHPLHHSPPLNSS-- 439
            ...|:::|.|.  |||   ||:|..|.|||     |..::........|.|..|....|...|  
Human   303 APPLESAEPLG--PAADLWADVDLTEFDQY-----LNCSRTRPDAPGLPYHVALAKLGPRAMSCP 360

  Fly   440 --ASLSSACSSASSQQPVAEYY 459
              :||.||.|.|||    |.||
Human   361 EESSLISALSDASS----AVYY 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 37/69 (54%)
SOX18NP_060889.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88 1/5 (20%)
SOX-TCF_HMG-box 84..155 CDD:238684 38/70 (54%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 87..100 10/12 (83%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 111..123 7/11 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..218 24/129 (19%)
Important for transcriptional activation. /evidence=ECO:0000250|UniProtKB:P43680 166..231 15/122 (12%)
Sox_C_TAD 193..382 CDD:288887 62/280 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..312 5/28 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.