DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox3

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001007502.1 Gene:sox3 / 493228 XenbaseID:XB-GENE-484815 Length:307 Species:Xenopus tropicalis


Alignment Length:366 Identity:94/366 - (25%)
Similarity:143/366 - (39%) Gaps:107/366 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHK 138
            :|.:||||||||||::..||.|:::.|.:.|||:||.||..||.|.||:|:||::.|::||..|.
 Frog    37 QERVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGADWKLLSDSEKRPFIDEAKRLRAVHM 101

  Fly   139 QEHPDYKYQPRRKKARVLPSQQSGEGG---SPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAA 200
            :|:|||||:||||...:|...:....|   :||    :|....|.|.       |||        
 Frog   102 KEYPDYKYRPRRKTKTLLKKDKYSLPGNLLAPG----VSPVASSVGV-------GQR-------- 147

  Fly   201 ADLGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASSMSSLTP 265
                  ..|.:|.|..:|.                 |.|||:..|                    
 Frog   148 ------IDTYAHMNGWTNG-----------------AYSLMQDQL-------------------- 169

  Fly   266 PATPYNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREYVAIGEVNYQGQSAGVQS 330
               .|:..|      ..|:|.  ::|:.......|..|..::.:.:.|:......|....|    
 Frog   170 ---GYSQHP------GMNSPQ--MQQIQHRYDMGGLQYSPMMSSAQTYMNAAASTYSMSPA---- 219

  Fly   331 GAEGGGAGQEMDFLENINGYGGYTGSRVSYPAYSYPANGGHFATEEQQQQQA----LQASEALNY 391
                  ..|:...:.::...|....|..|.|.   ||...|       .|:|    |:...::..
 Frog   220 ------YNQQSSTVMSLGSMGSVVKSEPSSPP---PAITSH-------TQRACLGDLRDMISMYL 268

  Fly   392 KPAAADIDPKEIDQYFMDQMLPMTQHHH----PHHTHPLHH 428
            .|.....||..:..   .::..:.||:.    |:.|.||.|
 Frog   269 PPGGDASDPSSLQS---SRLHSVHQHYQSAAGPNGTVPLTH 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 37/69 (54%)
sox3NP_001007502.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 1/3 (33%)
SOX-TCF_HMG-box 39..110 CDD:238684 38/70 (54%)
SOXp 109..189 CDD:372055 29/152 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.