DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and Sox102F

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster


Alignment Length:210 Identity:67/210 - (31%)
Similarity:94/210 - (44%) Gaps:36/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHK 138
            |.|||||||||||||:..||.:.|..|.:.||.:||.||..||.:.::||:|:.|...:|...|.
  Fly   420 KPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHM 484

  Fly   139 QEHPDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRR---AGKGNAA 200
            ::||||:|:||.|:..::          .|.:|.:     |..|....|...:.|   ...|..:
  Fly   485 EQHPDYRYRPRPKRTCIV----------DGKKMRI-----SEYKVLMRNRRAEMRQLWCRTGGVS 534

  Fly   201 ADLGS-CASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASSMSSLT 264
            ...|| ||......:.||||....:..|.:..|..      |..|...|.....|..       |
  Fly   535 GGSGSLCADACPKGSGGSNSQVAVAAAAAVYHLQD------MASSAASTAHGHDCGH-------T 586

  Fly   265 PPA----TPYNVAPS 275
            ||.    .|.:::||
  Fly   587 PPQQFFYPPESLSPS 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 35/69 (51%)
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 35/70 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451309
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.