DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox2

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_998869.1 Gene:sox2 / 407873 XenbaseID:XB-GENE-484553 Length:311 Species:Xenopus tropicalis


Alignment Length:328 Identity:89/328 - (27%)
Similarity:145/328 - (44%) Gaps:76/328 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WNLVQASAKAPTDRK-----------------KEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSE 106
            :|:::...|.|..::                 .:.:||||||||||::..||.|:::.|.:.|||
 Frog     2 YNMMETDLKPPAPQQASGGNSNSGSNNQSKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSE 66

  Fly   107 LSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRRKKARV-------LPSQQSGEG 164
            :||.||..||.|.:::|:||::.|::||..|.:|||||||:||||...:       ||......|
 Frog    67 ISKRLGAEWKLLSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPG 131

  Fly   165 GSPGPEMT--LSATMGSSGKPRS---SNSNGQRRAGKGNAAADLGSCASTISHANVGSNS----- 219
            .:|   ||  :.|::|:....|.   ::.||....|.|.....||    ...|..:.:::     
 Frog   132 ANP---MTSGVGASLGAGVNQRMDTYAHMNGWTNGGYGMMQEQLG----YPQHPGLSAHNAPQMQ 189

  Fly   220 ------------SDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASSMSSLTPP---ATP 269
                        :.:.|::.:|.. :...:.|..:|......|.|..|...|.||.:||   ::.
 Frog   190 PMHRYDVSALQYNSMSSSQTYMNG-SPTYSMSYSQQGAPGMSLGSMGSVVKSESSSSPPVVTSSS 253

  Fly   270 YNVAPSNAKASAANNPSLLL--RQLSEPVANAGDGYGVLLEAGREYVAIGEVNYQGQSAGVQSGA 332
            ::.||..| ....:..|:.|  .::.||.|.:      .|...:.|          |||.|...|
 Frog   254 HSRAPCQA-GDLRDMISMYLPGAEVPEPAAQS------RLHMSQHY----------QSASVAGTA 301

  Fly   333 EGG 335
            ..|
 Frog   302 ING 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 36/69 (52%)
sox2NP_998869.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 4/37 (11%)
SOX-TCF_HMG-box 36..107 CDD:238684 37/70 (53%)
SOXp 106..194 CDD:372055 21/94 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..259 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.