DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox21b

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001009888.1 Gene:sox21b / 406246 ZFINID:ZDB-GENE-040429-1 Length:245 Species:Danio rerio


Alignment Length:310 Identity:88/310 - (28%)
Similarity:120/310 - (38%) Gaps:122/310 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 EHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQ 139
            :|:||||||||||::|.||.|:::.|.:.|||:||.||..||.|.:|:|:||::.|::||..|.:
Zfish     6 DHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMK 70

  Fly   140 EHPDYKYQPRRKKARVLPSQQ--------SGE------GGSPGPEMTLSATMGSSGKPRSSNSNG 190
            |||||||:||||...::...:        .||      ||.|...:|           .|..||.
Zfish    71 EHPDYKYRPRRKPKTLMKKDKFAFPVAYNLGEHEALKVGGLPAGALT-----------ESLMSNP 124

  Fly   191 QRRAGKGNAAADLGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCS 255
            .:.|....|||                  :.||.|.:.          |....|..:.|      
Zfish   125 DKAAAAAAAAA------------------ARVFFNPSM----------SANPYSFFDLG------ 155

  Fly   256 TASSMSSLTPPATPYNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREYVAIGEVN 320
              |.|:.|:||:..|        ||....|:                                  
Zfish   156 --SKMTELSPPSFSY--------ASPLGYPT---------------------------------- 176

  Fly   321 YQGQSAGVQSGAEGGGAGQEMDFLENINGYGGYTGSRVS--YPAYSYPAN 368
                :|...|||.||||..             :|.|..|  .|.|..|.|
Zfish   177 ----AATAFSGAVGGGAHT-------------HTHSHPSPGNPGYMIPCN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 39/69 (57%)
sox21bNP_001009888.1 SOX-TCF_HMG-box 7..78 CDD:238684 40/70 (57%)
SOXp 77..>95 CDD:289133 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.