DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and D

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001261830.1 Gene:D / 39570 FlyBaseID:FBgn0000411 Length:382 Species:Drosophila melanogaster


Alignment Length:250 Identity:77/250 - (30%)
Similarity:116/250 - (46%) Gaps:50/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 APTDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEK 132
            |.:..::.||||||||||||::..||.::|..|.:.|||:||.||..||.|.:|:|:||::.|::
  Fly   133 ATSPGQEGHIKRPMNAFMVWSRLQRRQIAKDNPKMHNSEISKRLGAEWKLLAESEKRPFIDEAKR 197

  Fly   133 LRMTHKQEHPDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRAGKG 197
            ||..|.:|||||||:||||....|         :.||:..|....|..|:.:.....|   ||.|
  Fly   198 LRALHMKEHPDYKYRPRRKPKNPL---------TAGPQGGLQMQAGGMGQQKLGAGPG---AGAG 250

  Fly   198 --NAAADLGSCASTISHANVG-----SNSSDVFSNEAFMKSLNSACAASLMEQ------------ 243
              |....|....:...|.:.|     ....|..:.....:| .:|.||::..|            
  Fly   251 GYNPFHQLPPYFAPSHHLDQGYPVPYFGGFDPLALSKLHQS-QAAAAAAVNNQGQQQGQAPPQLP 314

  Fly   244 --------SLIETGLDSPCSTAS----------SMSSLTPPATPYNVAPSNAKAS 280
                    |.|.:|:.:|...|:          |.|:.:|.::|..:.|:....|
  Fly   315 PTSLSSFYSGIYSGISAPSLYAAHSANAAGLYPSSSTSSPGSSPGTITPNGMDGS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 39/69 (57%)
DNP_001261830.1 SOX-TCF_HMG-box 141..212 CDD:238684 40/70 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I4418
eggNOG 1 0.900 - - E1_KOG0527
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.