DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and Sox21b

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster


Alignment Length:388 Identity:105/388 - (27%)
Similarity:154/388 - (39%) Gaps:97/388 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LVQASAKAPTDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKP 125
            ::|.:.|.   :.:|||||||||||||::..||.:::..|.:.|||:||.||..||.|.:.:|:|
  Fly   235 MIQNTTKR---QNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRP 296

  Fly   126 FMEFAEKLRMTHKQEHPDYKYQPRRKKARVLPSQQSGEG---GSPGPEMTLSATMGSSGKPRSSN 187
            |::.|::||..|.:|||||||:||||     |.....:|   ..|.|.:.:.|.       |:..
  Fly   297 FIDEAKRLRAMHMKEHPDYKYRPRRK-----PKALRRDGYPYPMPYPSVPVEAL-------RAGI 349

  Fly   188 SNGQRRAGKGNAAADLGS-----CASTISHANVGSNSSDVFSNEAFMKSLNSACAA--------S 239
            :.|....|...||..|||     ...|.:.|.: |...|.|:.|......||:.|:        |
  Fly   350 TPGYFAPGPTAAAYHLGSHLGQTSTPTTTQATL-SGQMDKFALERSSYLSNSSQASAYSAYLDPS 413

  Fly   240 LMEQSLIETGL--DSPCSTASSMSSL----TPPATPYNVAPSNAKASAANNPSLLLRQLSEPVAN 298
            ::.::..::.:  |...:.|..:|.:    ...|..:.......:........|||.      ..
  Fly   414 VLTKAYFDSKMYQDRAANYAFDISKIYGAQQHAAAHHQQQQQQQQQQQQQQQQLLLS------GG 472

  Fly   299 AGDGYG--------------------VLLEA-------------GREYVAIGEVNYQGQSAGVQS 330
            .|.|.|                    ..|||             |.:|....: .|.||.|....
  Fly   473 GGSGGGGSASSHNNNSSSGLDDRDATPQLEAVESKPHLHSPSDVGLDYAQYAQ-QYGGQLAAAAG 536

  Fly   331 GAEGGGAGQEMDFLENINGYGGYTGSRVSYP---AYSYPANGGHFATEEQQQQQALQASEALN 390
            ||.||||......... .|.||.|.:....|   .: .|::.|               ||.||
  Fly   537 GAVGGGAAGAAGGSAG-GGSGGATAADFRRPLTVIFXPPSSNG---------------SEELN 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 37/69 (54%)
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 38/70 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451323
Domainoid 1 1.000 49 1.000 Domainoid score I4418
eggNOG 1 0.900 - - E1_KOG0527
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.