DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and MEIOSIN

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_011525873.1 Gene:MEIOSIN / 388553 HGNCID:44318 Length:644 Species:Homo sapiens


Alignment Length:202 Identity:44/202 - (21%)
Similarity:76/202 - (37%) Gaps:70/202 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDSSSSNCSKD-------------RAKPVET--------------LVLANYALKAEQKKAQGQGG 39
            |.||||:.|:|             :|.||.|              ..||:..|.||:|..:||  
Human   463 SSSSSSSSSEDSDSEPLWKQREDMQANPVGTPGSSEEDEDTTWTPTRLASPLLAAEKKATKGQ-- 525

  Fly    40 RKEDERITTAVMKVLEGYDWNLVQASAKAPTDRKK-----EHIKRPMNAFMVWAQAARRVMSKQY 99
                                 :.:|..| |.::||     :..|:.:|.|:::.:..|:...:..
Human   526 ---------------------VARAPVK-PKEKKKGPCPPQMKKKCVNGFIMFCRMNRKQYIRSC 568

  Fly   100 PHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQ--------------EHPDYKYQPRR 150
            |...::..:|.|.:||:.:...:::|:...|.:....|.:              |.|...||...
Human   569 PGTASTAATKELAQLWRVMTQQERRPYCTKARRFSRQHNRIVKQDGSSSEAEDWETPKPFYQLLA 633

  Fly   151 KKARVLP 157
            :||..||
Human   634 EKALPLP 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 14/83 (17%)
MEIOSINXP_011525873.1 HMG-box 547..606 CDD:294061 11/58 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.