DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and HMGB1

DIOPT Version :10

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_002119.1 Gene:HMGB1 / 3146 HGNCID:4983 Length:215 Species:Homo sapiens


Alignment Length:182 Identity:44/182 - (24%)
Similarity:80/182 - (43%) Gaps:39/182 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KDRAKPVETLVLANYAL-----KAEQKKAQ-------GQGGRKEDERITTAVMKVLEGYDWNLVQ 63
            |.|.|      :::||.     :.|.||..       .:..:|..||..|  |...|...:..:.
Human     8 KPRGK------MSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKT--MSAKEKGKFEDMA 64

  Fly    64 ASAKAPTDRK-KEHI----------------KRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSL 111
            .:.||..:|: |.:|                |||.:||.::....|..:..::|.|...:::|.|
Human    65 KADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKL 129

  Fly   112 GKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDY--KYQPRRKKARVLPSQQS 161
            |::|.|....||:|:.:.|.||:..::::...|  |.:|...|..|:.:::|
Human   130 GEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKS 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 HMG-box_SoxE 76..150 CDD:438840 23/91 (25%)
HMGB1NP_002119.1 Sufficient for interaction with HAVCR2. /evidence=ECO:0000250|UniProtKB:P63158 1..97 19/96 (20%)
LPS binding (delipidated). /evidence=ECO:0000269|PubMed:21660935 3..15 3/12 (25%)
HMG-box_HMGB_rpt1 8..76 CDD:438794 17/75 (23%)
Nuclear localization signal (NLS) 1. /evidence=ECO:0000250|UniProtKB:P63159 27..43 2/15 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..95 2/18 (11%)
LPS binding (Lipid A). /evidence=ECO:0000269|PubMed:21660935 80..96 0/15 (0%)
Cytokine-stimulating activity. /evidence=ECO:0000269|PubMed:12765338 89..108 5/18 (28%)
HMG-box_HMGB_rpt2 93..163 CDD:438795 19/69 (28%)
Binding to AGER/RAGE. /evidence=ECO:0000250|UniProtKB:P63159 150..183 8/32 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..215 6/21 (29%)
Nuclear localization signal (NLS) 2. /evidence=ECO:0000250|UniProtKB:P63159 178..184 1/4 (25%)

Return to query results.
Submit another query.