DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and Sox18

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001019952.1 Gene:Sox18 / 311723 RGDID:1311718 Length:377 Species:Rattus norvegicus


Alignment Length:397 Identity:113/397 - (28%)
Similarity:155/397 - (39%) Gaps:118/397 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 IKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEH 141
            |:||||||||||:..|:.:::|.|.|.|:.|||.|||.||.|..::|:||:|.||:||:.|.::|
  Rat    79 IRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERLRVQHLRDH 143

  Fly   142 PDYKYQPRRKK-ARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAAADLGS 205
            |:|||:||||| ||.:...:        |.:.|...:..|..|..             .||..||
  Rat   144 PNYKYRPRRKKQARKVRRLE--------PGLLLPGLVQPSAPPEP-------------FAAASGS 187

  Fly   206 CASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASSMSSLTPPATPY 270
            ..|......:|:....:              .....|:|.:: ||:|     ...|...||..|.
  Rat   188 ARSFRELPTLGAEFDGL--------------GLPTPERSPLD-GLES-----GEASFFPPPLAPE 232

  Fly   271 NVAPSNAKA----SAANNPSLLLRQLSEPVANAGDGYG-VLLEAGREYVAIGEVNYQGQSAGVQS 330
            :.|....:|    ..|.:||..              || .|.||.|.......:      ||:  
  Rat   233 DCALRAFRAPYAPELARDPSFC--------------YGSSLAEALRTAPPAAPL------AGL-- 275

  Fly   331 GAEGGGAGQEMDFLENINGYGGYTGSRVSYPAYSYPANGGHFATEEQQQQQALQASEALNYKPAA 395
                               |.|..|:...:|....|          ..:..:|:.:|.|  :|.|
  Rat   276 -------------------YYGTLGTPGPFPNPLSP----------PPEAPSLEGTEQL--EPTA 309

  Fly   396 ---ADIDPKEIDQYFMDQMLPMTQHHHPHHTH-PLHHPLHHSPPLNSS----ASLSSACSSASSQ 452
               ||:|..|.|||.      ......|..|. |.|..|....|...|    :||.||.|.||| 
  Rat   310 DLWADVDLTEFDQYL------NCSRTRPDATALPYHVALAKLGPRAMSCPEESSLISALSDASS- 367

  Fly   453 QPVAEYY 459
               |.||
  Rat   368 ---AVYY 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 37/68 (54%)
Sox18NP_001019952.1 SOX-TCF_HMG-box 78..149 CDD:238684 38/69 (55%)
Sox17_18_mid 191..239 CDD:403331 11/67 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.