DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox11b

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_571412.1 Gene:sox11b / 30603 ZFINID:ZDB-GENE-980526-466 Length:368 Species:Danio rerio


Alignment Length:348 Identity:92/348 - (26%)
Similarity:147/348 - (42%) Gaps:77/348 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DWNLVQASAKAPTDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSD 122
            ||      .|..|.    ||||||||||||::..||.:.:|.|.:.|:|:||.|||.||.||||:
Zfish    37 DW------CKTATG----HIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSE 91

  Fly   123 KKPFMEFAEKLRMTHKQEHPDYKYQPRRK---KARVLPSQQSGEGGSPGPEMTLSATMGSSGKPR 184
            |.||:..||:||:.|..::|||||:|::|   .:...|:.||       ||....:...::||..
Zfish    92 KIPFIREAERLRLQHMADYPDYKYRPKKKPKLDSSSKPAVQS-------PEKISKSVKAAAGKKC 149

  Fly   185 SSNSNGQRRAGKGNAAADLGSCASTISHANV----------------------GSNSSDVFSNEA 227
            :...  ..:.|...|.|....|.......|:                      ..:..|.:.:|.
Zfish   150 AKLK--PSKPGNITARASTQDCRFNYVFTNLKVTKSIKRELTDDEDDDDDDDDDDDEEDDYEDEE 212

  Fly   228 FMKSLNSACAASLMEQSLIETGLDSPCSTASSMSSLTPPATPY----NVAPSNAKASAANNPSLL 288
            .::..|...:.:|...:..|.|  :.....|..:|.||.:..:    |:...:|...|:.:|:..
Zfish   213 HIRLHNVPASPTLSSAAESEHG--ASMYEESRHTSATPGSRLFYNFKNITKQSAAYPASVSPASS 275

  Fly   289 LRQLSEPVANAGDGYGVLLEAGREYVAIGEVNYQ-GQSAGVQSGAEGGGAG--------QEMD-F 343
            .|.:|...:::.:....||           |::. ..:||..:...|..:|        :::| |
Zfish   276 FRSVSSSSSSSSEDSDDLL-----------VDFSLNLAAGSHTADLGNTSGNLCLSLVDKDLDSF 329

  Fly   344 LENINGYGGYTGSRVSYPAYSYP 366
            .|      |..||...:|.|..|
Zfish   330 SE------GSLGSHFEFPDYCTP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 40/69 (58%)
sox11bNP_571412.1 SOX-TCF_HMG-box 45..112 CDD:238684 37/66 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.