DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox11a

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_571411.1 Gene:sox11a / 30602 ZFINID:ZDB-GENE-980526-395 Length:354 Species:Danio rerio


Alignment Length:337 Identity:93/337 - (27%)
Similarity:145/337 - (43%) Gaps:64/337 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DWNLVQASAKAPTDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSD 122
            ||      .|..|.    ||||||||||||::..||.:.:|.|.:.|:|:||.|||.||.||||:
Zfish    32 DW------CKTATG----HIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSE 86

  Fly   123 KKPFMEFAEKLRMTHKQEHPDYKYQPRRKKARVLPS-QQSGEGGSPGPEMTLSATMGSSGKPR-S 185
            |.||:..||:||:.|..::|||||:|::|     |. ..|.:..:|.||.....:..|...|: .
Zfish    87 KIPFIREAERLRLKHMADYPDYKYRPKKK-----PKLDSSSKPSAPSPEKCSKTSKSSKKCPKLK 146

  Fly   186 SNSNGQRRA--GKGNAAADLGSCASTISH--ANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLI 246
            :|..|.:.:  |.|:..|...:..|...|  :.......|..|.|      :|.......|:..|
Zfish   147 ANKTGSKSSSHGYGDEYAFKSTKVSKTVHIKSEFTDEDDDDDSEE------DSRVRVKEEEEDPI 205

  Fly   247 E--TGLDSPCSTASSMSSLTPPATPY-------------NVAPSNAKASAANNPSLLLRQLSEPV 296
            .  .....|.|...|.|:.:..|:.|             |:...:....|:.:|: ..|.:|...
Zfish   206 RAYNVAKVPASPTLSSSTESEGASMYEEVRNNRLYYNFKNITKQSTMYPASVSPA-SSRSVSTSS 269

  Fly   297 ANAGDGYGVLLEAGREYVAIGEVNYQGQSAGVQSGAEGGG------AGQEMD-FLENINGYGGYT 354
            :::.|...:|.:.        .:|:...:...:.|::..|      ..:|:: |.|      |..
Zfish   270 SSSEDADDLLFDF--------SLNFASSAQSSELGSQNPGNLSLSLVDKELESFSE------GSL 320

  Fly   355 GSRVSYPAYSYP 366
            ||...:|.|..|
Zfish   321 GSHFEFPDYCTP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 40/69 (58%)
sox11aNP_571411.1 SOX-TCF_HMG-box 40..107 CDD:238684 37/66 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.